NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50568.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50568.1 Public Mus musculus 2 Slc25a25 21 106 86 CCDS HistoryNCBI Gene:227731Re-query CCDS DB by CCDS ID:50568.1Re-query CCDS DB by GeneID:227731See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50568.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113310 ENSMUSP00000108936 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113310Link to Ensembl Protein Viewer:ENSMUSP00000108936Re-query CCDS DB by Nucleotide ID:ENSMUST00000113310Re-query CCDS DB by Protein ID:ENSMUSP00000108936
Original member Current member EBI,WTSI OTTMUST00000028391 OTTMUSP00000012863 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000028391Link to Vega Protein Viewer:OTTMUSP00000012863Re-query CCDS DB by Nucleotide ID:OTTMUST00000028391Re-query CCDS DB by Protein ID:OTTMUSP00000012863
Original member Current member NCBI NM_001164357.1 NP_001157829.1 Accepted alive Link to Nucleotide Sequence:NM_001164357.1Link to Protein Sequence:NP_001157829.1Re-query CCDS DB by Nucleotide ID:NM_001164357Re-query CCDS DB by Protein ID:NP_001157829Link to BLAST:NP_001157829.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157829.1 502 A2ASZ8-2 502 100% 0 0

Chromosomal Locations for CCDS 50568.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 32416138 32416322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32416409 32416559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32417092 32417259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32417346 32417453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32417724 32417876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32419048 32419206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32420305 32420416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32421303 32421390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32421473 32421599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 32451067 32451324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1509 nt):
ATGGTGAGCAGTGTGTTGTGCCGCTGCGTGGCCTCCCCGCCGCCGGACGCCGCCGCCACCGCCTCGTCGT
CC
GCCTCGTCGCCGGCTTCTGTAGGGGACCCGTGCGGCGGCGCCGTCTGTGGCGGCCCGGACCACCAGCT
A
CGCCTGTGGAGCCTCTTCCAGACACTCGACGTCAACCGCGACGGCGGCCTGTGTGTCAACGACCTGGCG
GTG
GGGCTGCGGCGCCTGGGACTGCACCGCACGGAGGGCGAGCTCCGGAAAATTGTGCAAGCAGGTGACA
AG
GACCTTGATGGGCAACTGGACTTTGAAGAGTTTGTACATTACCTCCAAGATCATGAGAAAAAACTGAG
G
CTGGTGTTCAAGAGTCTGGACAAAAAGAATGATGGTCGAATCGATGCTCAGGAGATCATGCAGTCCCTG
CGG
GACCTGGGTGTCAAGATCTCGGAACAGCAGGCGGAGAAGATTCTTAAGAGCATGGATAAGAATGGCA
CG
ATGACCATCGACTGGAACGAGTGGAGGGACTACCACCTCCTGCACCCTGTGGAGAACATCCCGGAGAT
C
ATCCTGTACTGGAAGCACTCGACGATCTTCGATGTCGGTGAGAATCTGACAGTCCCAGATGAGTTCACA
GTG
GAGGAGAGGCAGACGGGGATGTGGTGGAGGCACCTGGTGGCAGGAGGTGGGGCAGGGGCAGTTTCCA
GA
ACCTGCACTGCCCCCCTGGACAGACTGAAGGTGCTCATGCAGGTCCATGCCTCCCGCAGCAACAACAT
G
TGCATCGTAGGTGGATTCACACAGATGATTCGAGAAGGGGGAGCCAAGTCACTCTGGCGGGGCAACGGC
ATC
AATGTCCTCAAAATTGCCCCTGAGTCGGCCATCAAATTCATGGCATATGAGCAGATGAAACGGCTTG
TC
GGTAGTGATCAGGAGACGCTGAGGATCCACGAAAGGCTTGTGGCAGGCTCCTTGGCCGGAGCCATTGC
C
CAGAGTAGCATCTACCCAATGGAGGTTCTGAAGACCCGAATGGCCCTGCGGAAAACAGGACAGTACTCC
GGC
ATGCTGGACTGTGCCAGGAGGATCTTGGCTAAAGAGGGTGTAGCTGCCTTCTACAAAGGCTACATCC
CC
AACATGCTGGGGATCATCCCCTATGCTGGCATCGACCTAGCTGTCTATGAGACATTGAAAAATACCTG
G
CTCCAGCGCTACGCAGTAAACAGTGCAGACCCCGGTGTGTTCGTGCTCCTGGCCTGTGGTACTATCTCC
AGT
ACTTGTGGCCAGCTGGCCAGCTACCCACTAGCCCTGGTCAGGACCCGGATGCAGGCACAAGCCTCCA
TT
GAGGGCGCACCTGAGGTAACCATGAGCAGCCTCTTCAAACAGATTCTGCGGACTGAGGGGGCCTTTGG
G
CTCTACCGGGGGCTGGCCCCCAACTTCATGAAGGTGATCCCGGCTGTGAGCATCAGCTACGTGGTCTAC
GAA
AACCTGAAGATCACCCTGGGCGTGCAGTCTCGGTGA


Translation (502 aa):
MVSSVLCRCVASPPPDAAATASSSASSPASVGDPCGGAVCGGPDHQLRLWSLFQTLDVNRDGGLCVNDLA
V
GLRRLGLHRTEGELR
KIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSL
R
DLGVKISEQQAEKILK
SMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFT
V
EERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQ
VHASRSNNMCIVGGFTQMIREGGAKSLWRGNG
I
NVLKIAPESAIKFMAYEQ
MKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYS
G
MLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYE
TLKNTWLQRYAVNSADPGVFVLLACGTIS
S
TCGQLASYPLALVRTRMQAQ
ASIEGAPEVTMSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVY
E
NLKITLGVQSR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser