NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50510.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50510.1 Public Mus musculus 2 Etl4 21 106 86 CCDS HistoryNCBI Gene:208618Re-query CCDS DB by CCDS ID:50510.1Re-query CCDS DB by GeneID:208618See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50510.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000114614 ENSMUSP00000110261 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114614Link to Ensembl Protein Viewer:ENSMUSP00000110261Re-query CCDS DB by Nucleotide ID:ENSMUST00000114614Re-query CCDS DB by Protein ID:ENSMUSP00000110261
Original member Current member EBI,WTSI OTTMUST00000026840 OTTMUSP00000012255 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000026840Link to Vega Protein Viewer:OTTMUSP00000012255Re-query CCDS DB by Nucleotide ID:OTTMUST00000026840Re-query CCDS DB by Protein ID:OTTMUSP00000012255
Original member Current member NCBI NM_029895.4 NP_084171.2 Accepted alive Link to Nucleotide Sequence:NM_029895.4Link to Protein Sequence:NP_084171.2Re-query CCDS DB by Nucleotide ID:NM_029895Re-query CCDS DB by Protein ID:NP_084171Link to BLAST:NP_084171.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_084171.2 1341 A2AQ25-4 1341 100% 0 0

Chromosomal Locations for CCDS 50510.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 20519858 20519927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20529959 20530242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20661898 20662096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20709405 20709603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20713355 20713448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20743459 20744291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20760215 20760264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20766445 20766611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20778026 20778201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20780942 20781072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20781798 20781945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20785044 20785467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20788428 20788611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20797877 20798031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20798616 20798783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20801542 20801661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20807902 20808024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 20808710 20809210 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4026 nt):
ATGGAAGAAAGCGAAGGCCAGAAATGTGAGCCGAACCTGCCTCCCTCCGGAGACAGCAGACAGATGCCCC
AA
CAAGGGAGAAGCAATCTTCATGTAACATCTCAGGAAGATGCAGCATGCCGCAGGCCCAGGGAACGCCT
T
TCTAATGGAAACGCCAGGGCTCAGGTTTCCAAGCCTGCCCGAAATATCCCAAGGAGACACACTCTAGGT
GGG
CCCCGAAGTTCCAAAGAGATCCTGGGAATGCAGCCATCTGAGATGGACAGGAAGAGAGAGGCGTTCC
TA
GAACATCTAAAGCAGAAGTACCCCCACCATGCCACAGCCATCATGGGCCACCAGGAGAGGCTGAGGGA
C
CAGACAAAAAGTCCCAAGCTGTCCCACAGTCCTCAACCTCCCAATTTGGGGGATCCGGTTGAACATTTA
TCA
GAGACATCTGGTGACTCTTTGGAAGCCATGTCCGAGGGAGAAGTACCGAGTCCTTTCGCCAGAGGCA
GT
CGTACTCGCGCGAGCCTTCCCGTGGTGAGGTCGGCCAATCAAACAAAGGAAAGATCCCTGGGTGTCCT
C
TACCTCCAGTATGGAGACGAAACCAAACAGCTGCGGATGCCGAATGAAGTCACAAGCACAGACACAATC
CGA
GCTCTCTTCGTCAGTGCCTTTCCCCAGCAGCTCACCATGAAGATGCTGGAGTCGCCCAGTGTTGCCA
TC
TACATCAAGGATGACAGCAGAAATGTCTACTATGAGTTAAATGATGTGAGGAATATCCAAGACAGATC
C
CTTCTCAAAGTATACAACAAGGATCCTTCACATGCATTTAACCACATGACGAAAGCCGTGAACGGAGAC
ATG
AGGATGCAGAGAGAAATTGTTTATGCAAGAGGAGATGGGCTTGTTGCCCCCCGACCAGGATCTGTGG
CT
CACCCACCTCATGTAATTCCAAACTCCCCACCATCAACTCCGGTGCCCCATTCCTTACCTCCCTCTCC
A
TCCAGAATTCCTTACGGGGGCAGCCGTCCAATGGCTATTCCTGGCAATGCCACCATCCCCAGGGACAGA
CTC
TCGAGCCTGCCAGTATCCAGATCCATCTCCCCAAGCCCCAGCGCCATTTTGGAAAGAAGAGATGTCA
AA
CCGGATGAAGACATGAGCAGCAAAAACCTGGTTATGTTCAGAAATGAGGGTTTCTATGCCGACCCTTA
C
CTCTATCATGAAGGACGAATGAGCATAGCCTCATCCCATGGCGGCCACCCTTTGGATGTCCCAGATCAT
GTC
ATTGCGTATCACCGCACAGCGATCCGGTCAGCGAGTGCTTACTGTAGCCCTTCCTTGCAAGCAGAAA
TG
CATATGGAGCAGTCGTTATACAGACAAAAGTCAAGGAAATACCCTGATAGCCATTTGCCTACCTTGGG
C
TCCAAAACGCCCCCAGCCTCTCCACACCGTGTGGGTGACTTAAGAATGATAGACCTGCACCCGCATCTT
AAC
ACACATGGGCCCCCTCACACTCTGCAGCCAGACCGGGCCTCCCCCAGTCGCCAGTCCTTTAAAAAGG
AA
CCCGGCACCCTGGTGTACATCGAAAAGCCACGAAACACTTCAGGATTATCCAGCCTTGTAGACCTGGG
G
CCTCCTCTAGTTGAGAAGCAAGGTTTTGCTTACAGCACCACTACAATCCCCAAAGACAGAGAAACCAGT
GAG
AAAATGGTGAAAGCCACAGCCAACAGGAACCAAGCAGATGGTGCAGGAACGGCCCATGTTTCTGCAG
GG
AAGGTTCTGGGCTCTGTGGAGTTCTCCCTGCCGCCCAGCCAACCCCTGCCTGCCGGAACCTCGCCCAT
C
CACACTAGCCTGCTTGACATGAGGAGGAACGTGGCTGAACTCAGGCTCCAACTCCAGCAGATGAGGCAG
CTC
CAGCTGCAGAACCAGGAGATTCTGAGGGCGATGATGAAGAAGGCTGAGCTGGAAATCAGTAACAAAG
TG
AAGGAGACCATGAAGAGACTAGAGGATCCGGTACAGCGTCAGCGCACCCTGGTGGAGCAAGAGAGACA
G
AAGTACCTCCACGAAGAAGAGCGGATTGTCAAAAAGTTATGTGAGCTGGAGGACTTTGTTGAGGACTTG
AAG
AAGGACTCTTCCTCCACTGGCAGAGTGGTGACCCTGAAAGATGTGGAAGATGGGGCTTTCCTCCTGC
GA
CAAGTGGGAGAAGCTGTGGCCACTCTCAAAGGAGAATTTCCAACTTTGCAAAATAAGATGCGTGCTGT
C
CTGCGCATAGAAGTTGAGGCAGTAAGGTTCCTGAAGGAAGAGCCACACAAGCTGGACAGTCTCCTGAAG
CGT
GTGAGGAGCATGACAGATGTCTTGACGATGTTGCGGAGGCATGTCACTGATGGGCTCCTGAAAGGCA
CC
GATGCATCCCAGGCTGCACAGTATGTTGCCATGGAGAAGGCCACAGCTGCAGAGGTCCTGAAGCATCA
G
GAAGAGACAGCCCATGCCCCTGGGCAACCCCTCCACTGTAGCACTGGAAGCCCTGGCGATGTGAAGTCA
GAA
GTGGTGCCCCTATCCACCATGACAGTTCACCATGTACAGAGCTCGCCTGTGGTCATGCAACCTTCCC
AG
CACTCCTCAGCCTTGATGAACCCAGCCCAGAACTTGCCTGGAGGAACCAGACCTCACACAGCCAGCCC
T
CCAGCAATCACACAGGAAGTAACCTCTGCCCAGTCAGCTCCAGGCCCCCAGTCCCCTCAGACCCCAGTG
AAT
GGTTCCTCCATGCAGAGCTTGTTCATTGAGGAAATTCACAGTAAGGCAGAAAAGAAATGGGAAGAAA
AA
AGGCAAAATCTGGAACACTATAACGGAAAGGAGTTCGAGAAGCTCCTGGAGGAAGCTCAGGCCAACAT
C
ATGAAGTCAATTCCAAACCTGGAGATGCCCCCAGCTTCCAGCCCAGTGTCAAAGGGAGATGCGGCAGGG
GAT
AAGCTGGAGCTGTCAGAAGATTCTCCAAATTCAGAGCAGGAATTGGACAAGATAGGGGGAAAGTCAC
CC
CCTCCTCCACCCCCACCCCCTCGGAGAAGCTACCTTCCTGGATCAGGACTTACCACCACGAGATCAGG
C
GATGTGGTCTACACTGGCAGGAGCATGTCTAAGGTGAGCAGTGAAGACCCTGGGCCAACACCACAGACT
AGA
GCCACAAAATGTCCCCCGGAGGAACCTGCCTCAGCCTGGGCCCCATCCCCACCACCAGTCCCTGCCC
CT
TCCTCCAAGGAGGAGGAGGAAGAAGAAGAAGAAGGAGACAAAATCATGGCAGAACTCCAGGCATTCCA
G
AAGTGTTCCTTTATGGATGTAAATCCAAACAGTCATGCTGAGCAGTCCCGAGCTAACAGCCACCTTAAA
GAC
ACTAGGGCAGGCGCCACAGCCCCACCCAAGGAGAAGAAGGGCTCCAGCACCACCCCACAGACAAGCC
GG
ATGCCAGTCCCCATGACTTCCAAGAACAGACCCGGAAGCCTGGATAAGGCCAGCAAGCAGTCCAAACT
A
CAGGATCCCCGCCAATACCGTCAGGCTAATGGAAGTGCTAAGAAAGCTGGTGGGGACTGTAAGCCTACT
TCC
CCCTCCTTACCTGCTTCTAAGATTCCAGCCCTTTCTCCCAGCTCTGGGAAAAGCAGTTCTCTGCCTT
CC
GCTAGTGGGGACAGCTCTAACCTCCCCAATGCACCTGCTACTAAACCATCGATTGCTTCTACCCCTCT
C
AGCCCCCAAGCAGGACGGTCCGCTCACTCCGCTTCCCTCATCCCTTCTGTCTCTAATGGCTCCTTAAAG
TTT
CAGAGCCCACCTCACGCAGGTAAAGGCCATCATCACCTTTCGTTCGCACTGCAGACTCAAAATGGCC
GA
GCTGCCCCTACTACCTCTTCCTCCTCATCCCCTCCTTCCCCTGCCTCCCCCACCTCCCTGAATCAAGG
T
GCCAGGGGCATCAGGACCATCCATACTCCTAGCCTCGCCAGCTACAAAGCACAGAATGGAAGTTCAAGC
AAA
GCCACCCCATCCACAGCAAAAGAAACGTCTTAA


Translation (1341 aa):
MEESEGQKCEPNLPPSGDSRQMPQQGRSNLHVTSQEDAACRRPRERLSNGNARAQVSKPARNIPRRHTLG
G
PRSSKEILGMQPSEMDRKREAFLEHLKQKYPHHATAIMGHQERLRDQ
TKSPKLSHSPQPPNLGDPVEHL
S
ETSGDSLEAMSEGEVPSPFARGSRTRASLPVVRSANQTKERSL
GVLYLQYGDETKQLRMPNEVTSTDTI
R
ALFVSAFPQQLTMKMLESPSVAIYIKDDSRNVYYELNDV
RNIQDRSLLKVYNKDPSHAFNHMTKAVNGD
M
R
MQREIVYARGDGLVAPRPGSVAHPPHVIPNSPPSTPVPHSLPPSPSRIPYGGSRPMAIPGNATIPRDR
L
SSLPVSRSISPSPSAILERRDVKPDEDMSSKNLVMFRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDH
V
IAYHRTAIRSASAYCSPSLQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVGDLRMIDLHPHL
N
THGPPHTLQPDRASPSRQSFKKEPGTLVYIEKPRNTSGLSSLVDLGPPLVEKQGFAYSTTTIPKDRET
S
E
KMVKATANRNQADGA
GTAHVSAGKVLGSVEFSLPPSQPLPAGTSPIHTSLLDMRRNVAELRLQLQQMRQ
L
Q
LQNQEILRAMMKKAELEISNKVKETMKRLEDPVQRQRTLVEQERQKYLHEEERIVKKLCELEDFVEDL
K
KDSSSTGRVVTLKDVEDGAFLLRQVGEAVATLK
GEFPTLQNKMRAVLRIEVEAVRFLKEEPHKLDSLLK
R
VRSMTDVLTMLR
RHVTDGLLKGTDASQAAQYVAMEKATAAEVLKHQEETAHAPGQPLHCSTGSPGDVKS
E
VVPLSTMTVHHVQSSPVVMQPSQHSSALMNPAQNLPGGTRPHTASPPAITQEVTSAQSAPGPQSPQTPV
N
GSSMQSLFIEEIHS
KAEKKWEEKRQNLEHYNGKEFEKLLEEAQANIMKSIPNLEMPPASSPVSKGDAAG
D
KLELS
EDSPNSEQELDKIGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRSMSKVSSEDPGPTPQT
R
ATKCPPEEPASAWAPSPPPVPAPSSKEEEEEEEEGDKIMAELQ
AFQKCSFMDVNPNSHAEQSRANSHLK
D
TRAGATAPPKEKK
GSSTTPQTSRMPVPMTSKNRPGSLDKASKQSKLQDPRQYRQANGSAKKAGGDCKPT
S
PSLPASKIPALSPSSGKSSSLPSASGDSSNLPNAPATKPSIASTPLSPQAGRSAHSASLIPSVSNGSLK
F
QSPPHAGKGHHHLSFALQTQNGRAAPTTSSSSSPPSPASPTSLNQGARGIRTIHTPSLASYKAQNGSSS
K
ATPSTAKETS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser