NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50425.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50425.1 Public Mus musculus 19 Hectd2 21 106 86 CCDS HistoryNCBI Gene:226098Re-query CCDS DB by CCDS ID:50425.1Re-query CCDS DB by GeneID:226098See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50425.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000169036 ENSMUSP00000128387 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169036Link to Ensembl Protein Viewer:ENSMUSP00000128387Re-query CCDS DB by Nucleotide ID:ENSMUST00000169036Re-query CCDS DB by Protein ID:ENSMUSP00000128387
Original member Current member EBI,WTSI OTTMUST00000111201 OTTMUSP00000062183 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000111201Link to Vega Protein Viewer:OTTMUSP00000062183Re-query CCDS DB by Nucleotide ID:OTTMUST00000111201Re-query CCDS DB by Protein ID:OTTMUSP00000062183
Original member Current member NCBI NM_001163471.1 NP_001156943.1 Accepted alive Link to Nucleotide Sequence:NM_001163471.1Link to Protein Sequence:NP_001156943.1Re-query CCDS DB by Nucleotide ID:NM_001163471Re-query CCDS DB by Protein ID:NP_001156943Link to BLAST:NP_001156943.1

Chromosomal Locations for CCDS 50425.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 36554784 36554915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36569373 36569502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36583936 36584074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36584896 36584998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36585444 36585533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36587366 36587430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36595209 36595254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36597077 36597186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36598887 36599035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36599596 36599719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36601429 36601528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36604250 36604357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36605168 36605300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36606386 36606474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36609265 36609423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36611364 36611438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36612144 36612231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36612317 36612423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36614348 36614463 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36615500 36615643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 36618724 36618844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2328 nt):
ATGAGTGAGGCGGCTCGGGATCTCTCGCCCGGAGCGCCGCCGGCGGTAGCCGCGGCCGCCCCGGAGGAGA
GG
AAGGGGAAAGAACCGGAGCGCGAGAAGCTGCCGCCCATCGTGACGGCCGGCGCAGCCGCGGGCTTGGA
C
AGAGGATCCAAGGGCCAGATTTCCACCTTCAGCAGCTTTGTCTCGACTGTCACCCAGAAGAAGGAAGCT
GCT
GAGAACAGAAGCTCGCCTACCCACCTTGCTCTCCCTAACATCAGGAATGTGAGAGACCTACCACCAA
TT
TGTCTTGATGTTAGACAAAAACAGCGCATGTCTGTGGAAGCGTTACCATCTGAAGTGAAGGTCCCGCC
C
CTTCCAGAACCTTCTCTTCCTAGCCAGCCCAAAACTGTAAAAGACTTTGAGGAAGATTTAGAAAAAGCT
GAG
GCCACAGGGAATTGGAAGACAGTACATGCTTTTTATATAACAGCATTTGATTCTTTCACAGAACTAA
AC
ACTGCATTTAAGAAAGATGCCACGGCCTCATTTAATACTATTGAGGACTCTGGGCTTAATGCCAATTT
G
GTGAATGCTGTGTTTGATGCCTTACTTAATACTCCTCAAGATATCCAGAAGTCAGTATTGAAGGGAATC
ATT
AACAGCTTGTTACAAGAATGGAAAGGTCCACGAACAAAAGATGATCTTAGAGCATATTTTATACTGT
TA
CAGAATCCTCAATTTAATATCACATCTACATATGTCATCTATGCTCATTTGCTACGACAGATAGCTAC
C
TTAGTGGAAGCTGACCATCACTTCCTAGTTCACTGGCTTAAAAAATTATCCCAGAAGAAATTCAAGCAA
CTG
GTAGAGAGATTGCTGCAATTTGTTTCTTTACGGCTGTTTCCAGCAAAACCTGAAGAATTCCCGCCTC
TA
ACGAAGTGTACCTGGTGGATCCCATCAGCCGCTAAAGTTCTGGCTTTGCTTAACACTGCCAACAATTT
G
GTTCACCCTCCCCTCGTTCCTTACACTGATTTCTATAATTCTACCCTGGATCACATTGATCTCATGGAA
GAG
TATCACACGTGGCAGAGCTTTGGGAACTCTCACAGCAGGTTTTCCTTCTGTCAGTACCCATTCGTTA
TT
TCTATAGCTGCAAAAAAAATCATTATTCAAAGAGACTCAGAACAACAGATGATAAGCATCGCAAGGCA
A
AGTCTGGTGGATAAAGTATCTCGAAGACAAAGACCTGATATGAATATGTTATTTCTAAATATGAAAGTA
AGG
AGGACACATCTGGTTAGCGACTCACTTGATGAGTTAACCCGGAAGAGAGCTGACTTGAAGAAGAAGT
TG
AAAGTTACATTTGTAGGTGAAGCTGGTTTGGATATGGGCGGCTTGACTAAAGAATGGTTCCTTCTTCT
A
ATTCGCCAGATTTTCCATCCAGATTATGGCATGTTTACATACCACAAGGATTCACACTGCCATTGGTTT
AGC
AGCTTTAAATGTGATAACTATTCTGAATTCCGATTGGTTGGAATTCTCATGGGACTAGCTGTTTATA
AC
AGCATCACCTTGGATATTCGTTTTCCTCCCTGCTGTTACAAAAAATTACTGAGCCCTCCTGTCGTACC
A
AGTGATCAGAGTACACCAGTAGGCATCTGCAGTGTTACCATTGACGACTTGTGCCAGGTTATGCCTGAA
TTG
GCCCATGGACTAAAGGAACTTTTATCATATGAAGGCAACGTTGAAGAAGATTTCTATTCAACATTTC
AG
GTTTTTCAAGAAGAATTTGGAGTAATTAAATCCTATAACTTAAAACCAGGGGGTGATAAGATTCCAGT
T
ACCAATCAGAATAGAAGAGAGTATGTACAGCTTTATACTGACTTCCTGTTGAACAAATCTATCTATAAG
CAA
TTTGCTGCATTTTACTGTGGATTTCATAGTGTGTGTGCTTCAAATGCCCTAATGCTGCTTCGTCCAG
AA
GAAGTAGAAATCCTGGTTTGTGGCAGTCCTGAACTGGATATGCATGCACTGCAGAGGAGCACACAGTA
C
GACGGCTATGCGAAGACAGACCTGACCATACGATACTTTTGGGATGTTGTGCTTGGATTTCCACTTGAA
CTT
CAGAAAAAGCTGTTACACTTTACTACAGGAAGCGACAGAGTACCTGTTGGAGGGATGGCTGATTTGA
AT
TTTAAAATTTCAAAGAATGAAACTTCTACTAACTGGTTACCTGTGGCACACACTTGTTTCAATCAACT
C
TGCCTTCCCCCATACAAGAGCAAAAAAGATCTGAAACAGAAACTGATTATTGGAATTTCAAATTCAGAA
GGT
TTTGGACTTGAATAA


Translation (775 aa):
MSEAARDLSPGAPPAVAAAAPEERKGKEPEREKLPPIVTAGAAAGLDRGSKGQISTFSSFVSTVTQKKEA
A
ENRSSPTHLALPNIRN
VRDLPPICLDVRQKQRMSVEALPSEVKVPPLPEPSLPSQPKTVKDFEEDLEKA
E
ATGNWKTVHAFYITAFDSFTELNTAFK
KDATASFNTIEDSGLNANLVNAVFDALLNTPQDIQKSVLKGI
I
NSLLQEWK
GPRTKDDLRAYFILLQNPQFNITSTYVIYAHLLRQIATLVEADHHFLVHWLKKLSQKKFKQ
L
VERLLQFVSLRLFPAKPEEFPPLTKCTWWIPSAAKVLALL
NTANNLVHPPLVPYTDFYNSTLDHIDLME
E
YHTWQSFGNSH
SRFSFCQYPFVISIAAKKIIIQRDSEQQMISIARQSLVDKVSRRQRPDMNMLFLNMKV
R
RTHLVSDSLDE
LTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKDSHCHWF
S
SFKCDNYSEFRLVGI
LMGLAVYNSITLDIRFPPCCYKKLLSPPVVPSDQSTPVGICSVTIDDLCQVMPE
L
AHGLKELLSYEGNVEEDFYSTFQ
VFQEEFGVIKSYNLKPGGDKIPVTNQNRREYVQLYTDFLLNKSIYK
Q
FAAFYCGFHSVCASNALM
LLRPEEVEILVCGSPELDMHALQRSTQYDGYAKTDLTIRYFWDVVLGFPLE
L
QKKLLHFTTGSDRVPVGGMADLNFKISKNETSTN
WLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSE
G
FGLE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser