NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS50346.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50346.1 Public Mus musculus 19 Unc93b1 21 106 86 CCDS HistoryNCBI Gene:54445Re-query CCDS DB by CCDS ID:50346.1Re-query CCDS DB by GeneID:54445See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 50346.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000165711 ENSMUSP00000128751 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165711Link to Ensembl Protein Viewer:ENSMUSP00000128751Re-query CCDS DB by Nucleotide ID:ENSMUST00000165711Re-query CCDS DB by Protein ID:ENSMUSP00000128751
Original member Current member NCBI NM_001161428.1 NP_001154900.1 Accepted alive Link to Nucleotide Sequence:NM_001161428.1Link to Protein Sequence:NP_001154900.1Re-query CCDS DB by Nucleotide ID:NM_001161428Re-query CCDS DB by Protein ID:NP_001154900Link to BLink:NP_001154900.1

Chromosomal Locations for CCDS 50346.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 3935194 3935352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3935762 3935903 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3936269 3936422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3941520 3941681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3941885 3942017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3942349 3942442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3942694 3942818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3943529 3943711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 3947007 3947123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGAAGGAAGTCCCAACCAGCTGCTGGTGCCCAGAACTGCAAGCCCTTGATCTGGATCTGGTCATGGAGG
TG
GAGCCTCCGCTCTACCCTGTGGCCGGGGCCGCGGGTCCTCAAGGGGATGAAGACCGGCACGGAGTTCC
T
GATGGGCCAGAGGCTCCCTTGGACGAACTCGTGGGTGCGTACCCCAACTACAATGAGGAGGAGGAAGAG
CGC
CGCTACTACCGCCGCAAGCGCCTCGGAGTGGTCAAGAACGTGCTGGCGGCCAGCACGGGTGTCACCC
TT
ACTTACGGCGTCTACCTGGGCCTCCTGCAGATGCAACTGATCCTGCACTATGATGAGACCTACAGAGA
G
GTGAAGTATGGCAACATGGGGCTGCCGGACATCGATAGCAAGATGCTGATGGGTATCAACGTGACGCCT
ATC
GCTGCCCTGCTCTACACACCTGTGCTCATCAGGTTTTTTGGTACCAAGTGGATGATGTTCTTGGCTG
TG
GGCATCTATGCCCTCTTTGTCTCTACCAACTACTGGGAACGCTACTACACGCTGGTGCCCTCTGCTGT
G
GCTCTGGGCATGGCCATTGTGCCTCTGTGGGCCTCCATGGGCAACTATATCACCAGGATGTCCCAGAAG
TAC
TATGAATACTCCCACTACAAGGAGCAAGATGAGCAGGGACCTCAGCAGCGCCCACCACGAGGTTCCC
AC
GCACCCTATCTCCTGGTTTTCCAGGCCATCTTCTATAGCTTCTTCCACTTGAGCTTCGCGTGTGCCCA
G
CTGCCCATGATTTACTTCCTCAACAACTACCTGTATGACCTGAACCACACACTGATCAACGTGCAGAGC
TGC
GGTACTAAGAGCCAAGGCATTCTGAATGGCTTCAACAAGACGGTCCTTCGGACGCTGCCGCGCAGCA
AA
AACCTTATTGTTGTAGAGAGCGTGCTCATGGCGGTGGCCTTCTTGGCCATGCTGATGGTGCTGGGCCT
G
TGTGGAGCCGCTTACCGGCCCACGGAAGAGATCGACCTGCGCAGCGTGGGCTGGGGCAACATCTTCCAG
CTG
CCCTTCAAACACGTGCGTGACTTTCGCTTACGCCATCTGGTGCCCTTCTTTATCTACAGTGGCTTTG
AG
GTGCTCTTTGCCTGCACTGGTTTTGCCCTGCACTCCTGGGCATCCTATATGAAGACAAAGAGAGGCAG
G
ACTTCATCTTCACCATCTATCACTGGTGGCAGGCCGTGGCCATCTTTGTTGTGTACCTGGGCTCCAGCT
TGC
CCATGA


Translation (422 aa):
MKEVPTSCWCPELQALDLDLVMEVEPPLYPVAGAAGPQGDEDRHGVPDGPEAPLDELVGAYPNYNEEEEE
R
RYYRRKRLGVVKNVLAASTGVTLTYGVYL
GLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTP
I
AALLYTPVLI
RFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMSQK
Y
YEYSHYKEQDEQGPQQRPPRGSHAPYLLVFQAIFYSFFH
LSFACAQLPMIYFLNNYLYDLNHTLINVQS
C
GTKSQGILNGFNKTVLRTLPRSKNLIVVESVLMAVAFLAMLMVLGLCGAAYRPTEEIDLRSVGWGNIFQ
L
PFKHVRDFRLRHLVPFFIYSGFEVLFACTGFAL
HSWASYMKTKRGRTSSSPSITGGRPWPSLLCTWAPA
C
P




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser