NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49825.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49825.1 Public Mus musculus 16 Rnf168 21 106 86 CCDS HistoryNCBI Gene:70238Re-query CCDS DB by CCDS ID:49825.1Re-query CCDS DB by GeneID:70238See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49825.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000171474 ENSMUSP00000126484 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171474Link to Ensembl Protein Viewer:ENSMUSP00000126484Re-query CCDS DB by Nucleotide ID:ENSMUST00000171474Re-query CCDS DB by Protein ID:ENSMUSP00000126484
Original member Current member NCBI NM_027355.2 NP_081631.2 Accepted alive Link to Nucleotide Sequence:NM_027355.2Link to Protein Sequence:NP_081631.2Re-query CCDS DB by Nucleotide ID:NM_027355Re-query CCDS DB by Protein ID:NP_081631Link to BLink:NP_081631.2

Chromosomal Locations for CCDS 49825.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 32278109 32278415 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 32282311 32282387 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 32285370 32285549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 32289119 32289240 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 32291903 32291981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 32298388 32299326 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1704 nt):
ATGAAGATGGCTGCACCTAAAACCTCCATCCCTTCCTTAGCCGAATGTCAGTGCGGGATCTGTATGGAAA
TC
CTCCTAGAGCCTGTAACCCTACCTTGCAACCACACGCTCTGTAACCCATGCTTCCAGTCCACTGTTGA
A
AAGGCCAATCTATGCTGTCCCTTCTGTCGTCGCCGGGTCTCTTCGTGGACTCGGTACCATACCCGAAGA
AAT
TCTCTGGTCAATACAGACCTGTGGGAGATTATTCAAAAACACTATGCAAAGGAATGCAAGCTTAGAA
TC
TCTGGACAAGAATCAAAGGAAATCATTGATGAGTGCCAGCCAGTTCGTCGGCTCAGTGAACCTGGGGA
G
TTGAGGCGAGAATATGAAGAGGAGATAAGCAGGGTGGAGGCTGAGCGACAAGCCAGCAAGGAAGAGGAA
AAC
AAAGCCAGTGAGGAGTACATCCAGAGATTGTTGGCTGAGGAGGAGGAGGAGGAGAAAAGACAGAGAG
AA
AAAAGAAGAAGTGAGATGGAAGAACAGCTGAGAGGCGATGAAGAACTGGCTAGGAGCCTGAGCACCAG
T
ATCAACAGCAACTATGAGAGAAATACCTTGGCTTCTCCTTTGAGTTCCAGAAAATCAGATCCAGTCACA
AAC
AAGTCCCAGAAGAAAAATACAAGTAAACAAAAAACCTTTGGAGATATTCAAAAATATTTGTCACCTA
AG
TTGAAGCCTGGGACCGCCTTGGCATGTAAGGCTGAGCTTGAGGAAGACATCTGCAAGTCTAAGGAAAC
T
GATAGGAGTGACACGAAGAGCCCTGTGTTGCAAGACACAGAAATTGAAAAAAATATACCAACACTTTCT
CCT
CAGACCTGCCTGGAAACTCAAGAACAAGGTTCGGAGTCTTCTGCAGGGATACCCGGGCCACAGTTAT
GT
GTAGGAGACACTAAAGAGTCCCTTGAGGGAAAAGTTGAAACAGTATCAACCAGTCCTGATGATTTATG
T
ATTGTAAATGATGATGGACCTAGAGCCACAGTTTTTTACTCTAATGAAGCTGCAGTTAACTCTTCTAGT
AAA
ATAGAAAATGAAGAATACTCTGTGACAGGTGTGCCCCAGTTAACTGGGGGCAACAGAGTTCCAACAG
AG
AGTAGAGTGTATCACTTACTAGTTGAAGAAGAGATTTCCGACAGAGAAAACCAGGAATCTGTATTTGA
A
GAAGTCATGGATCCATGTTTTTCTGCAAAAAGAAGGAAAATATTCATCGAATCCTCCTCAGATCAAGAA
GAA
ACAGAAGTGAATTTTACACAAAAACTGATAGATTTGGAACATATGCTTTTTGAGAGACATAAGCAAG
AA
GAGCAGGACAGATTGTTAGCATTACAACTTCAGAAAGAGGTAGATAAAGAGCAAATGGTGCCAAACCG
G
CAGAAAGGATCCCCAGATCAGTACCAGCTACGCACACCCTCACCCCCAGACAGGCTGCTGAATAGACAA
AGG
AAGAATTCCAAAGATAGGAACTCCCTACAGCAAACTAATGCAGATCACTCAAAATCTCCGAGGAACA
CA
AAAGGTGACTATTGGGAGCCCTTTAAAAACACATGGAAGGATTCAGTTAATGGAACAAAGATGCCAAC
T
TCTACTCAAGATAATTGTAATGTATCTAAAAGTGCCTATACCGTACAGCATAGAAAGTCCCAGAGAAGC
ATT
GTTCAAATGTTTCAGAGATAA


Translation (567 aa):
MKMAAPKTSIPSLAECQCGICMEILLEPVTLPCNHTLCNPCFQSTVEKANLCCPFCRRRVSSWTRYHTRR
N
SLVNTDLWEIIQKHYAKECKLRISGQESKEI
IDECQPVRRLSEPGELRREYEEEISRVEAERQASKEEE
N
KASEEYIQRLLAEEEEEEKRQREKRRSEMEEQLRGDEELARSLSTSI
NSNYERNTLASPLSSRKSDPVT
N
KSQKKNTSKQKTFGDIQ
KYLSPKLKPGTALACKAELEEDICKSKETDRSDTKSPVLQDTEIEKNIPTLS
P
QTCLETQEQGSESSAGIPGPQLCVGDTKESLEGKVETVSTSPDDLCIVNDDGPRATVFYSNEAAVNSSS
K
IENEEYSVTGVPQLTGGNRVPTESRVYHLLVEEEISDRENQESVFEEVMDPCFSAKRRKIFIESSSDQE
E
TEVNFTQKLIDLEHMLFERHKQEEQDRLLALQLQKEVDKEQMVPNRQKGSPDQYQLRTPSPPDRLLNRQ
R
KNSKDRNSLQQTNADHSKSPRNTKGDYWEPFKNTWKDSVNGTKMPTSTQDNCNVSKSAYTVQHRKSQRS
I
VQMFQR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser