NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49812.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49812.1 Public Mus musculus 16 Trp63 21 106 86 CCDS HistoryNCBI Gene:22061Re-query CCDS DB by CCDS ID:49812.1Re-query CCDS DB by GeneID:22061See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 49812.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115305 ENSMUSP00000110960 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115305Link to Ensembl Protein Viewer:ENSMUSP00000110960Re-query CCDS DB by Nucleotide ID:ENSMUST00000115305Re-query CCDS DB by Protein ID:ENSMUSP00000110960
Original member Current member EBI,WTSI OTTMUST00000049681 OTTMUSP00000023064 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049681Link to Vega Protein Viewer:OTTMUSP00000023064Re-query CCDS DB by Nucleotide ID:OTTMUST00000049681Re-query CCDS DB by Protein ID:OTTMUSP00000023064
Original member Current member NCBI NM_001127263.1 NP_001120735.1 Accepted alive Link to Nucleotide Sequence:NM_001127263.1Link to Protein Sequence:NP_001120735.1Re-query CCDS DB by Nucleotide ID:NM_001127263Re-query CCDS DB by Protein ID:NP_001120735Link to BLink:NP_001120735.1

Chromosomal Locations for CCDS 49812.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 25802060 25802101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25820388 25820642 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25862279 25862465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25863675 25863790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25865247 25865356 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25866075 25866211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25868167 25868249 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25870997 25871133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 25876627 25876741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1182 nt):
ATGTTGTACCTGGAAAACAATGCCCAGACTCAATTTAGTGAGCCACAGTACACGAACCTGGGGCTCCTGA
AC
AGCATGGACCAGCAGATTCAGAACGGCTCCTCGTCCACCAGCCCCTACAACACAGACCACGCACAGAA
T
AGCGTGACGGCGCCCTCGCCCTATGCACAGCCCAGCTCCACCTTTGATGCCCTCTCTCCATCCCCTGCC
ATT
CCCTCCAACACAGATTACCCGGGCCCACACAGCTTCGATGTGTCCTTCCAGCAGTCAAGCACTGCCA
AG
TCAGCCACCTGGACGTATTCCACCGAACTGAAGAAGCTGTACTGCCAGATTGCGAAGACATGCCCCAT
C
CAGATCAAGGTGATGACCCCACCCCCACAGGGCGCTGTTATCCGTGCCATGCCTGTCTACAAGAAAGCT
GAG
CATGTCACCGAGGTTGTGAAACGATGCCCTAACCATGAGCTGAGCCGTGAGTTCAATGAGGGACAGA
TT
GCCCCTCCCAGTCATCTGATTCGAGTAGAAGGGAACAGCCATGCCCAGTATGTAGAAGATCCTATCAC
G
GGAAGGCAGAGCGTGCTGGTCCCTTATGAGCCACCACAGGTTGGCACTGAATTCACAACAGTCCTGTAC
AAT
TTCATGTGTAACAGCAGCTGCGTCGGAGGAATGAACAGACGTCCAATTTTAATCATCGTTACTCTGG
AA
ACCAGAGATGGGCAAGTCCTGGGCCGACGGTGCTTTGAGGCCCGGATCTGTGCTTGCCCAGGAAGAGA
C
CGGAAGGCAGATGAAGACAGCATCAGAAAGCAGCAAGTATCGGACAGCGCAAAGAACGGCGATGGTACG
AAG
CGCCCTTTCCGTCAGAATACACACGGAATCCAGATGACTTCCATCAAGAAACGGAGATCCCCAGATG
AT
GAGCTGCTGTACCTACCAGTGAGAGGTCGTGAGACGTACGAGATGTTGCTGAAGATCAAAGAGTCACT
G
GAGCTCATGCAGTACCTCCCTCAGCACACGATCGAAACGTACAGGCAGCAGCAGCAGCAGCAGCACCAG
CAC
CTACTTCAGAAACATCTCCTTTCAGCCTGCTTCAGGAATGAGCTTGTGGAGCCCCGGGGAGAAGCTC
CG
ACACAGTCTGACGTCTTCTTTAGACATTCCAACCCCCCAAACCACTCCGTGTACCCATAG


Translation (393 aa):
MLYLENNAQTQFSEPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPA
I
PSNTDYPGPHSFDVSFQQSSTAKSATWT
YSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKA
E
HVTEVVKRCPNHELSREFNE
GQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLY
N
FMCNSSCVGGMNRRPILIIVTLETR
DGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGT
K
R
PFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQ
H
LLQK
HLLSACFRNELVEPRGEAPTQSDVFFRHSNPPNHSVYP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser