NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49682.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49682.1 Public Mus musculus 15 Serhl 21 106 86 CCDS HistoryNCBI Gene:68607Re-query CCDS DB by CCDS ID:49682.1Re-query CCDS DB by GeneID:68607See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 49682.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078218 ENSMUSP00000077345 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078218Link to Ensembl Protein Viewer:ENSMUSP00000077345Re-query CCDS DB by Nucleotide ID:ENSMUST00000078218Re-query CCDS DB by Protein ID:ENSMUSP00000077345
Original member Current member EBI,WTSI OTTMUST00000091324 OTTMUSP00000050301 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000091324Link to Vega Protein Viewer:OTTMUSP00000050301Re-query CCDS DB by Nucleotide ID:OTTMUST00000091324Re-query CCDS DB by Protein ID:OTTMUSP00000050301
Original member Current member NCBI NM_023475.3 NP_075964.1 Accepted alive Link to Nucleotide Sequence:NM_023475.3Link to Protein Sequence:NP_075964.1Re-query CCDS DB by Nucleotide ID:NM_023475Re-query CCDS DB by Protein ID:NP_075964Link to BLAST:NP_075964.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075964.1 311 Q9EPB5-1 311 100% 0 0

Chromosomal Locations for CCDS 49682.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 83100344 83100347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83101644 83101793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83101872 83101985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83102299 83102340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83102625 83102644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83102934 83103008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83104309 83104421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83105611 83105690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83112210 83112244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83114357 83114439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83115567 83115663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 83116257 83116379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (936 nt):
ATGGGTTTGCACTCAGAGTTGAAGTTGGCTGTGCCCTGGGGCCACATTGCTCTCAAAGTCTGGGGCTCCC
AG
AAGAACCCTCCAGTTCTCTGCTTACACGGCTGGCTGGACAACGCCAACTCCTTTGACAGGCTCATTCC
T
CTTCTTCCCCAAGACTTCTGTTACATGGCTATGGATTTCGGAGGCCACGGGCTCTCGTCCCATTACAAC
CCA
GGCCTCCCGTACTACCAGCAAAATTTTGTGAGTGAGGTCCGAAGGGTGGCAACAGCCTTTAAGTGGA
AT
CAGTTCACCCTCCTGGGCCACAGTTTTGGTGGCTGTGTGGGTGGCACGTTCGCCTGCATGTTCCCTGA
G
ATGGTGGACAAACTGATCTTGCTGGACTCAACGCCATTTTTCCTGGACTCTAATGAAATGGAGAACATA
CTG
ACCTACAGGCGGAGAAACATAGAGCACACACTTCAGGTGGAGGCCTCCCAGAAAAAGTCCCTGAGAG
CT
GTCAGCCCAGAGGAGATGTTGCAGGGGTTCCTGAATAACAACAGCCACTTGGATAAAGACTGTGGGGA
A
CTCATCCTACAGAGAGGAACCACGAAGGTGGACGCAGGTCTGGTGCTGAACAGGGACCGGAGGATCTCT
TGG
CCAGAGAACAGCTTTGACTTCGTAAGCAAGGAGATGTTCGTGCACTCTGCGAAGAGCCTGCAGGCCA
GC
GTGCTAATGATCAAAGCGCTGCAGGGGTACTACGATGTGAGGCGGGCGAATGATGCAGACAAGGCGCC
T
ATGCACTTCATGGTGGACACACTAAGATCCACCCTAAAGGAGCGGTTCCAGTTTGTGGAAGTCCCAGGC
AAT
CACTACATCCACATGAACAAGCCCCAGGTGGTGGCCGGAGTCGTCGGTCCCTTCCTACAGGGCCTAC
AG
AGGATGACTTCTGCCAGGCTGTAG


Translation (311 aa):
MGLHSELKLAVPWGHIALKVWGSQKNPPVLCLHGWLDNANSFDRLIPLLPQDFCYMAMDFGGHGLSSHYN
P
GLPYYQQNFVSEVRRVAT
AFKWNQFTLLGHSFGGCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENI
L
TYRRRNIEHTLQVEASQKKSLRAVSPEEMLQ
GFLNNNSHLDKDCGELILQRGTTKVDAGLVLNRDRRIS
W
PENSFDFVSKEMFVHSAKSLQASVLMIKALQGYYDVRRANDADKAPMHFMVDTLRSTLKERFQFVEVPG
N
HYIHMNKPQVVAGVVGPFLQGLQRMTSARL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser