NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49368.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49368.1 Public Mus musculus 13 Ndufs4 21 106 86 CCDS HistoryNCBI Gene:17993Re-query CCDS DB by CCDS ID:49368.1Re-query CCDS DB by GeneID:17993See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49368.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022286 ENSMUSP00000022286 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022286Link to Ensembl Protein Viewer:ENSMUSP00000022286Re-query CCDS DB by Nucleotide ID:ENSMUST00000022286Re-query CCDS DB by Protein ID:ENSMUSP00000022286
Original member Current member NCBI NM_010887.2 NP_035017.2 Accepted alive Link to Nucleotide Sequence:NM_010887.2Link to Protein Sequence:NP_035017.2Re-query CCDS DB by Nucleotide ID:NM_010887Re-query CCDS DB by Protein ID:NP_035017Link to BLAST:NP_035017.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035017.2 175 Q9CXZ1 175 99.4286% 0 1

Chromosomal Locations for CCDS 49368.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 114288763 114288866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 114307817 114307890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 114316857 114317029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 114351448 114351526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 114387959 114388056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (528 nt):
ATGGCGGCGGTCTCAATGTCAGTGTCGCTGAGACAGGCGATGTTGGGGCGAAGGGCAATGGCTACAGCTG
CC
GTTTCCGTCTGTAGAGTTCCATCCAGGTTGTTGAGCACATCCACTTGGAAGCTGGCAGACAACCAGAC
T
CGGGACACACAGCTTATAACAGTTGATGAGAAACTGGATATCACAACTTTAACTGGTGTTCCAGAAGAG
CAC
ATCAAAACCAGAAAGGTCAGAATCTTTGTTCCTGCTCGCAATAACATGCAGTCTGGAGTAAATAACA
CA
AAGAAATGGAAGATGGAGTTTGATACCAGAGAGAGATGGGAAAATCCTTTGATGGGTTGGGCATCAAC
C
GCTGACCCCCTCTCCAACATGGTTCTGACCTTCAGTGCCAAAGAAGATGCAATTGCCTTTGCAGAAAAA
AAC
GGATGGAGCTATGATGTGGAAGAGAAGAAGGTTCCGAAACCCAAGTCCAAGTCTTATGGTGCAAACT
TT
TCTTGGAACAAAAGAACAAGAGTGTCTACAAAATAG


Translation (175 aa):
MAAVSMSVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEE
H
IKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWAS
TADPLSNMVLTFSAKEDAIAFAEK
N
GWSYDVEEKKVPKPKSKSYGANFSWNKRTRVSTK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser