NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49243.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49243.1 Public Mus musculus 13 Tfap2a 21 106 86 CCDS HistoryNCBI Gene:21418Re-query CCDS DB by CCDS ID:49243.1Re-query CCDS DB by GeneID:21418See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49243.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021787 ENSMUSP00000021787 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021787Link to Ensembl Protein Viewer:ENSMUSP00000021787Re-query CCDS DB by Nucleotide ID:ENSMUST00000021787Re-query CCDS DB by Protein ID:ENSMUSP00000021787
Original member Current member NCBI NM_001122948.2 NP_001116420.1 Accepted alive Link to Nucleotide Sequence:NM_001122948.2Link to Protein Sequence:NP_001116420.1Re-query CCDS DB by Nucleotide ID:NM_001122948Re-query CCDS DB by Protein ID:NP_001116420Link to BLink:NP_001116420.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001116420.1 431 P34056-3 431 99.768% 0 1

Chromosomal Locations for CCDS 49243.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 40717115 40717403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 40719192 40719333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 40721269 40721387 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 40723091 40723322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 40725129 40725180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 40728342 40728776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 40730039 40730065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1296 nt):
ATGTTAGTTCACAGTTTTTCAGCTATGGACCGTCACGACGGCACCAGCAACGGGACGGCACGGTTGCCCC
AG
CTGGGCACTGTAGGTCAATCTCCCTACACCAGCGCCCCGCCGCTGTCCCACACCCCTAATGCCGACTT
C
CAGCCTCCCTACTTCCCCCCGCCCTACCAGCCTATCTACCCCCAGTCGCAAGATCCTTACTCCCACGTC
AAC
GACCCCTACAGCCTGAATCCTCTGCACGCCCAGCCGCAGCCGCAGCACCCGGGCTGGCCCGGTCAGA
GG
CAGAGCCAGGAATCTGGGCTCTTACACACACACCGGGGCTTACCCCACCAACTGTCGGGCCTGGACCC
T
CGCAGGGACTATCGGCGGCACGAGGACCTCTTGCACGGCCCGCACGGGCTCGGCTCTGGGCTCGGGGAC
CTC
CCGATCCACTCCTTACCTCACGCCATCGAGGACGTCCCGCACGTAGAAGACCCGGGTATTAACATCC
CA
GATCAAACTGTAATTAAGAAAGGCCCCGTGTCCCTGTCCAAGTCCAACAGCAATGCTGTCTCCGCCAT
C
CCTATTAACAAGGACAACCTCTTCGGTGGCGTGGTAAACCCCAACGAAGTCTTCTGTTCAGTTCCGGGT
CGC
CTGTCGCTCCTCAGCTCCACCTCGAAGTACAAGGTCACGGTGGCGGAAGTACAGCGGCGCCTCTCAC
CG
CCCGAGTGTCTTAACGCGTCGCTCCTGGGCGGAGTACTGCGGAGAGCGAAGTCTAAGAATGGAGGGAG
A
TCTTTAAGAGAAAAACTGGACAAGATAGGATTGAATCTGCCAGCAGGGAGACGTAAAGCTGCCAACGTT
ACC
CTCCTCACGTCACTAGTGGAAGGAGAAGCCGTCCACCTAGCCAGGGACTTTGGGTACGTGTGCGAAA
CT
GAATTTCCTGCCAAAGCAGTAGCAGAATTTCTCAACCGACAACATTCCGATCCCAATGAGCAAGTGGC
A
AGAAAAAACATGCTCCTGGCCACAAAACAGATCTGCAAAGAGTTCACTGACCTGCTGGCTCAGGACCGA
TCT
CCCCTGGGGAACTCGCGGCCCAATCCTATCCTGGAGCCTGGCATCCAGAGTTGCTTGACCCACTTCA
AC
CTCATCTCCCATGGCTTCGGCAGCCCGGCGGTGTGTGCAGCGGTTACGGCCCTGCAGAACTATCTCAC
C
GAGGCCCTCAAGGCCATGGACAAAATGTACCTCAGCAACAACCCCAACAGCCACACGGACAACAGCGCC
AAA
AGCAGTGACAAAGAAGAGAAACACAGAAAGTGA


Translation (431 aa):
MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHV
N
DPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHGLGSGLGD
L
PIHSLPHAIEDVP
HVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPG
R
LSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLR
RAKSKNGGRSLREKLDKIGLNLPAGRRKAANV
T
LLTSLVE
GEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDR
S
PLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSA
K
SSDKEEKHRK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser