NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49094.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49094.1 Public Mus musculus 12 Max 21 106 86 CCDS HistoryNCBI Gene:17187Re-query CCDS DB by CCDS ID:49094.1Re-query CCDS DB by GeneID:17187See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49094.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000082136 ENSMUSP00000080778 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000082136Link to Ensembl Protein Viewer:ENSMUSP00000080778Re-query CCDS DB by Nucleotide ID:ENSMUST00000082136Re-query CCDS DB by Protein ID:ENSMUSP00000080778
Original member Current member NCBI NM_001146176.1 NP_001139648.1 Accepted alive Link to Nucleotide Sequence:NM_001146176.1Link to Protein Sequence:NP_001139648.1Re-query CCDS DB by Nucleotide ID:NM_001146176Re-query CCDS DB by Protein ID:NP_001139648Link to BLAST:NP_001139648.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139648.1 151 P28574-2 151 100% 0 0

Chromosomal Locations for CCDS 49094.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 76938568 76938755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 76939967 76940090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 76953169 76953276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 76961990 76962025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (456 nt):
ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGCTGACAAGCGGGCTCACCATAATGCACTGGAAC
GA
AAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGA
G
AAGGCATCCCGGGCCCAAATCCTAGACAAAGCAACAGAGTATATCCAGTATATGCGAAGGAAAAACCAT
ACG
CACCAGCAAGACATTGATGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAACAAGTCCGTGCACTGG
AG
AAGGCAAGATCAAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGC
C
AAGGGCGGCACCATCTCTGCCTTCGATGGGGGTTCAGACTCCAGCTCAGAATCCGAGCCTGAAGAGCCC
CAG
AGCAGGAAGAAACTCCGGATGGAGGCCAGCTAA


Translation (151 aa):
MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH
T
HQQDIDDLKRQNALLEQQ
VRALEKARSSAQLQTNYPSSDNSLYTNAKGGTISAFDGGSDSSSESEPEEP
Q
SRKKLRMEAS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser