NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49056.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49056.1 Public Mus musculus 12 Nrcam 21 106 86 CCDS HistoryNCBI Gene:319504Re-query CCDS DB by CCDS ID:49056.1Re-query CCDS DB by GeneID:319504See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49056.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020939 ENSMUSP00000020939 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020939Link to Ensembl Protein Viewer:ENSMUSP00000020939Re-query CCDS DB by Nucleotide ID:ENSMUST00000020939Re-query CCDS DB by Protein ID:ENSMUSP00000020939
Original member Current member NCBI NM_176930.4 NP_795904.3 Accepted alive Link to Nucleotide Sequence:NM_176930.4Link to Protein Sequence:NP_795904.3Re-query CCDS DB by Nucleotide ID:NM_176930Re-query CCDS DB by Protein ID:NP_795904Link to BLink:NP_795904.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_795904.3 1256 Q810U4-1 1256 100% 0 0

Chromosomal Locations for CCDS 49056.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 44532554 44532659 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44537251 44537356 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44539441 44539637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44540952 44541074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44544725 44544895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44545379 44545435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44547232 44547343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44549874 44550058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44551305 44551436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44559662 44559805 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44562427 44562538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44563964 44564130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44564227 44564374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44566288 44566412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44566840 44566869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44568544 44568645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44570210 44570407 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44570506 44570576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44571515 44571740 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44572202 44572317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44573820 44574024 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44575876 44575998 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44576604 44576780 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44578145 44578180 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44584835 44584987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44590108 44590239 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44590981 44591059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 44598350 44598587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3771 nt):
ATGCAGCTTAAAATAATGCCGAAGAAGAAGCACTTATCTGCAGGCGGAGTGCCCCTGATTCTCTTCCTGT
GC
CAGATGATCAGCGCGCTGGATGTTCCTCTCGATCTGGTACAACCTCCAACCATCACTCAACAGTCACC
A
AAAGACTACATCATTGACCCTCGGGAGAATATTGTAATCCAGTGTGAGGCCAAAGGGAAACCTCCCCCA
AG
C
TTTTCCTGGACTCGTAATGGAACTCACTTTGACATAGACAAGGACCCTCTGGTCACCATGAAGCCTG
GC
TCAGGAACCCTTGTCATCAACATCATGAGTGAGGGGAAGGCAGAGACCTATGAAGGAGTCTACCAGTG
C
ACTGCAAGGAACGAGCGTGGAGCTGCCGTCTCCAATAACATTGTTGTCCGCCCATCTAGGTCACCCTTG
TGG
ACCAAGGAAAGACTTGAACCTATAGTACTCCAGAATGGGCAGTCATTAGTACTTCCATGTAGGCCTC
CG
ATTGGATTACCTCCGGCCATAATATTTTGGATGGATAATTCCTTTCAGAGACTTCCACAGAGTGAGCG
G
GTTTCCCAAGGCCTAAATGGAGACCTTTACTTCTCCAATGTCCTCCCAGAGGACACCCGTGAGGACTAT
ATC
TGCTATGCCAGATTTAATCACACTCAAACCATCCAGCAGAAGCAGCCTATTTCTTTGAAGGTGATTT
CA
GTGGATGAATTGAATGACACTATAGCTGCTAATTTGAGTGACACTGAGTTTTATGGTGCTAAATCTAG
T
AAAGAGAGGCCCCCAACGTTTCTAACTCCAGAGGGCAATGAAAGCCACAAAGAGGAATTAAGAGGAAAC
GTG
CTTTCGCTGGAGTGCATTGCGGAAGGCCTACCTACTCCAATTATTTACTGGATCAAAGAAGACGGAA
TG
CTTCCCGCCAACCGGACATTTTATCGGAACTTTAAGAAAACCCTGCAGATCACTCATGTTTCCGAAGC
C
GACTCTGGAAATTATCAGTGCATAGCAAAAAACGCATTAGGAGCCGTCCATCACACCATTTCTGTCACT
GTT
AAAGCGGCTCCCTACTGGATCGTGGCACCTCAAAACCTCGTGCTTTCCCCGGGAGAGAATGGGACCC
TC
ATCTGCAGAGCTAATGGCAACCCGAAACCCAGAATTAGCTGGTTAACAAATGGAGTCCCAATAGAAAT
T
GCTCTCGATGACCCCAGCAGAAAAATAGATGGCGATACCATTATATTTTCAAATGTTCAAGAAAGCTCA
AGT
GCGGTTTATCAGTGCAATGCCTCTAACAAATATGGATATTTACTAGCAAATGCATTTGTAAATGTTC
TC
GCTGAACCACCTCGGATTCTCACATCAGCAAACACACTGTACCAGGTCATTGCAAACAGGCCTGCTTT
G
CTAGATTGTGCCTTCTTTGGATCTCCTATGCCTACCATTGAGTGGTTTAAAGGCACTAAAGGAAGCGCT
CTT
CATGAAGACATTTATGTTTTGCATGATAATGGAACATTAGAAATTCCCGTGGCCCAAAAGGATAGTA
CA
GGGACGTATACTTGTGTCGCACGGAATAAACTAGGGATGGCAAAGAATGAAGTTCACTTGGAAATCAA
A
GATCCAACCAGGATCATTAAACAACCTGAGTATGCAGTCGTCCAGAGGGGGAGCAAGGTGTCCTTTGAA
TGC
AGAGTGAAACATGACCACACCTTAATCCCCACCATTATGTGGCTGAAGGACAATGGAGAGCTGCCCA
AT
GATGAAAGGTTCTCCACTGACAAGGATCATCTGGTGGTATCTGATGTAAAGGATGACGATGGCGGAAC
C
TACACGTGTACGGCCAACACAACGCTGGACAGTGCTTCGGCCAGCGCTGTGCTCAGGGTTGTCGCTCCT
ACT
CCAACTCCAGCCCCCATTTACGATGTCCCGAATCCTCCCTTTGATTTAGAATTGACCAATCAACTTG
AC
AAAAGTGTTCAGCTGACATGGACCCCAGGCGACGACAACAATAGCCCCATTACAAAATTCATCATTGA
G
TATGAAGATGCAATGCATGATGCAGGGCTGTGGCGCCACCAGGCTGAAGTTTCTGGAACACAGACCACA
GCC
CAACTGAAGCTGTCTCCCTATGTGAACTACTCCTTCCGTGTCATGGCAGAGAACAGCATTGGGAGAA
GT
ATGCCGAGCGAGGCATCCGAGCAGTATCTTACAAAAGCCGCAGAACCAGATCAGAATCCCATGGCTGT
G
GAAGGACTAGGGACAGAGCCGGACAACTTGGTGATTACATGGAAGCCCCTGAATGGTTTTCAATCGAAT
GGG
CCTGGCCTCCAGTACAAAGTGAGCTGGCGCCAGAAAGATGGTGACGATGAGTGGACGTCTGTGGTTG
TG
GCCAATGTATCCAAATACATTGTTTCTGGCACACCAACCTTTGTCCCATACCTGATAAAAGTTCAAGC
T
CTGAATGATGTGGGGTTTGCACCAGAGCCAGCTGCAGTCATGGGGCATTCTGGAGAAGACCTTCCAATG
GTG
GCTCCTGGAAATGTTCGCGTCAGCGTGGTGAACAGTACGCTGGCAGAGGTGCACTGGGACCCAGTTC
CT
CCCAAGAGTGTCCGAGGACACTTACAAGGCTACCGGATTTACTACTGGAAGACCCAGAGCTCCTCTAA
A
AGAAACAGGCGCCACATTGAGAAGAAGATCCTCACCTTCCAGGGCACCAAGACTCACGGCATGCTGCCA
GGG
CTGCAGCCATACAGTCACTATGCCCTCAACGTCCGAGTGGTCAACGGGAAAGGGGAGGGCCCAGCCA
GC
ACGGACAGAGGCTTCCATACACCGGAGGGAGTCCCTAGTGCTCCCTCATCTTTGAAAATTGTTAATCC
C
ACACTGGACTCCCTCACTTTGGAATGGGACCCCCCAAGCCACCCAAATGGCATCCTGACTGAGTACATC
TTA
CAATATCAGCCAATTAACAGCACACATGAGCTAGGCCCTCTGGTAGATTTAAAAATTCCTGCCAACA
AG
ACCCGCTGGACTTTGAAAAATTTAAATTTCAGCACTCGGTACAAGTTCTATTTCTATGCACAGACATC
A
GTGGGGCCAGGCAGTCAGATCACAGAGGAAGCGATAACGACTGTGGACGAAGCTGGTATTCCTCCACCT
GAT
GTAGGTGCAGGCAAAGGCAAAGAAGAATGGAGGAAAGAAATTGTAAATGGTTCTCGAAGCTTCTTTG
GG
TTAAAGGGTCTAATGCCAGGAACAGCATACAAAGTTCGAGTTGGTGCTGAGGGGGACTCTGGTTTTGT
G
AGTTCAGAGGATGTGTTTGAGACAGGACCAGCAATGGCAAGCCGGCAAGTGGATATCGCGACCCAAGGC
TGG
TTCATAGGTCTAATGTGCGCTGTTGCTCTCCTCATCTTAATTTTGCTGATTGTTTGCTTCATCAGAA
GA
AACAAAGGTGGTAAATACCCAGTTAAAGAAAAGGAGGATGCTCATGCAGACCCTGAAATCCAGCCCAT
G
AAGGAAGATGATGGGACGTTTGGAGAATACAGTGATGCAGAAGATCACAAGCCTTTGAAAAAAGGAAGT
CGA
ACACCTTCAGACAGGACTGTGAAAAAAGAAGATAGCGATGATAGTCTGGTTGACTATGGAGAGGGGG
TG
AACGGCCAATTCAACGAGGATGGCTCCTTTATTGGCCAATACAGTGGTAAGAAAGAGAAAGAGCCAGC
A
GAGGGAAATGAAAGCTCAGAGGCCCCTTCTCCTGTCAACGCAATGAACTCCTTTGTTTAA


Translation (1256 aa):
MQLKIMPKKKHLSAGGVPLILFLCQMISALDVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPP
S
FSWTRNGTHFDIDKDPLVTMKPGSGTLVINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPL
W
TKERLEPIVLQNGQSLVLPCRPPIGLPPAIIFWMDN
SFQRLPQSERVSQGLNGDLYFSNVLPEDTREDY
I
CYARFNHTQTIQQKQPISLKVIS
VDELNDTIAANLSDTEFYGAKSSKERPPTFLTPEGNESHKEELRGN
V
LSLECIAEG
LPTPIIYWIKEDGMLPANRTFYRNFKKTLQITHVSEADSGNYQCIAKNALGAVHHTISVT
V
K
AAPYWIVAPQNLVLSPGENGTLICRANGNPKPRISWLTNGVPIEIALDDPSRKIDGDTIIFSNVQESS
S
AVYQCNASNKYGYLLANAFVNVL
AEPPRILTSANTLYQVIANRPALLDCAFFGSPMPTIEWFKGTKGSA
L
HEDIYVLHDNGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIK
DPTRIIKQPEYAVVQRGSKVSFE
C
RVKHDHTLIPTIMWLKDNGELPNDE
RFSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLRVVAP
T
PTPAPIY
DVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHDAGLWRHQAEVSGTQTT
A
QLKLSPYVNYSFRVMAENSIGRSMPSEASEQYLTKAA
EPDQNPMAVEGLGTEPDNLVITWKPLNGFQSN
G
PGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVGFAPEPAAVMGHSGED
LPM
V
APGNVRVSVVNSTLAEVHWDPVPPKSVRGHLQGYR
IYYWKTQSSSKRNRRHIEKKILTFQGTKTHGMLP
G
LQPYSHYALNVRVVNGKGEGPASTDRGFHTPEG
VPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYI
L
QYQP
INSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSVGPGSQITEEAITTVDEAGIPPP
D
VGAGK
GKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDVFETGPAMASRQVDIATQG
W
FIGLMCAVALLILILLIVCFIRRNKGGKYP
VKEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGS
R
TPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser