NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48746.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48746.1 Public Mus musculus 11 Dbnl 21 106 86 CCDS HistoryNCBI Gene:13169Re-query CCDS DB by CCDS ID:48746.1Re-query CCDS DB by GeneID:13169See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48746.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020769 ENSMUSP00000020769 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020769Link to Ensembl Protein Viewer:ENSMUSP00000020769Re-query CCDS DB by Nucleotide ID:ENSMUST00000020769Re-query CCDS DB by Protein ID:ENSMUSP00000020769
Original member Current member EBI,WTSI OTTMUST00000011398 OTTMUSP00000005312 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011398Link to Vega Protein Viewer:OTTMUSP00000005312Re-query CCDS DB by Nucleotide ID:OTTMUST00000011398Re-query CCDS DB by Protein ID:OTTMUSP00000005312
Original member Current member NCBI NM_001146308.1 NP_001139780.1 Accepted alive Link to Nucleotide Sequence:NM_001146308.1Link to Protein Sequence:NP_001139780.1Re-query CCDS DB by Nucleotide ID:NM_001146308Re-query CCDS DB by Protein ID:NP_001139780Link to BLAST:NP_001139780.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139780.1 436 Q62418-1 436 100% 0 0

Chromosomal Locations for CCDS 48746.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 5788560 5788642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5791792 5791847 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5793650 5793762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5794237 5794311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5795448 5795594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5796746 5796823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5797024 5797175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5797275 5797335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5797627 5797720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5798016 5798111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5798216 5798325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5799234 5799339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 5799860 5799999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1311 nt):
ATGGCGGTGAACCTGAGCCGGAACGGGCCGGCGCTGCAGGAGGCCTACGTGCGCGTAGTCACCGAGAAAT
CC
CCGACCGACTGGGCTCTTTTTACCTATGAAGGCAACAGCAATGACATCCGTGTGGCTGGCACAGGAGA
G
GGAGGCCTGGAGGAGCTGGTGGAAGAGCTCAACAGCGGGAAGGTGATGTACGCCTTCTGCAGGGTGAAG
GAC
CCCAACTCCGGCCTGCCCAAGTTTGTCCTCATCAACTGGACAGGAGAGGGTGTGAATGATGTGCGGA
AA
GGAGCATGTGCCAACCACGTCAGCACCATGGCCAACTTCCTGAAGGGTGCCCACGTGACCATCAATGC
C
CGGGCCGAGGAGGATGTGGAGCCTGAGTGCATCATGGAGAAGGTTGCCAAGGCCTCTGGGGCCAACTAC
AGC
TTCCATAAGGAAAGCACCTCCTTCCAGGATGTAGGGCCGCAGGCCCCAGTGGGCTCTGTGTACCAGA
AG
ACCAATGCCATATCTGAGATCAAGAGAGTCGGCAAGGATAACTTCTGGGCCAAAGCTGAGAAGGAAGA
A
GAGAACCGCCGCCTGGAGGAGAAGCGGCGTGCCGAAGAGGAGCGGCAGCGGTTGGAGGAGGAGCGACGA
GAG
CGGGAGCTGCAGGAGGCTGCCCGACGTGAGCAGCGCTACCAGGAACAGCACAGATCAGCTGGAGCCC
CG
AGCCCTTCCAGCAGGACAGGTGAGCCAGAGCAGGAAGCCGTTTCAAGGACCAGACAGGAGTGGGAGTC
T
GCTGGGCAGCAGGCCCCACACCCACGAGAGATTTTCAAGCAGAAGGAAAGGGCAATGTCCACCACCTCT
GTC
ACCAGCTCGCAGCCGGGCAAGCTGAGGAGCCCCTTCCTGCAGAAGCAACTCACTCAACCAGAAACCT
CC
TACGGCCGAGAGCCCACAGCTCCTGTCTCCCGGCCTGCAGCAGGTGTCTGTGAGGAGCCAGCGCCTAG
C
ACTCTGTCTTCTGCCCAGACAGAAGAAGAACCTACATATGAAGTACCCCCAGAGCAGGACACCCTCTAT
GAG
GAACCACCACTGGTACAGCAGCAAGGGGCTGGCTCCGAACACATTGACAACTACATGCAGAGCCAGG
GC
TTCAGTGGACAAGGGCTGTGCGCCCGGGCCTTGTATGACTACCAGGCAGCTGATGACACCGAGATCTC
C
TTTGACCCTGAGAACCTAATCACAGGCATCGAGGTGATTGACGAAGGCTGGTGGCGAGGCTATGGGCCT
GAC
GGCCACTTTGGCATGTTTCCTGCCAACTACGTGGAGCTCATAGAGTGA


Translation (436 aa):
MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSGKVMYAFCRVK
D
PNSGLPKFVLINW
TGEGVNDVRKGACANHVSTMANFLKGAHVTINARAEEDVEPECIMEKVAKASGANY
S
FHKESTSFQDVGPQAPV
GSVYQKTNAISEIKRVGKDNFWAKAEKEEENRRLEEKRRAEEERQRLEEERR
E
RELQEAARREQRYQEQHRSAGAP
SPSSRTGEPEQEAVSRTRQEWESAGQQAPHPREIFKQKERAMSTTS
V
TSSQP
GKLRSPFLQKQLTQPETSYGREPTAPVSRPAAGVCEEPAPSTLSSAQTEEEPTYEVPPEQDTLY
E
EPPL
VQQQGAGSEHIDNYMQSQGFSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGP
D
GHFGMFPANYVELIE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser