NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48523.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48523.1 Public Mus musculus 10 Arg1 21 106 86 CCDS HistoryNCBI Gene:11846Re-query CCDS DB by CCDS ID:48523.1Re-query CCDS DB by GeneID:11846See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 48523.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020161 ENSMUSP00000020161 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020161Link to Ensembl Protein Viewer:ENSMUSP00000020161Re-query CCDS DB by Nucleotide ID:ENSMUST00000020161Re-query CCDS DB by Protein ID:ENSMUSP00000020161
Original member Current member NCBI NM_007482.3 NP_031508.1 Accepted alive Link to Nucleotide Sequence:NM_007482.3Link to Protein Sequence:NP_031508.1Re-query CCDS DB by Nucleotide ID:NM_007482Re-query CCDS DB by Protein ID:NP_031508Link to BLAST:NP_031508.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031508.1 323 Q61176 323 100% 0 0

Chromosomal Locations for CCDS 48523.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 24915610 24915779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24916028 24916164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24916355 24916459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24916775 24916869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24917913 24918072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24920623 24920797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24922621 24922693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 24927312 24927368 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (972 nt):
ATGAGCTCCAAGCCAAAGTCCTTAGAGATTATCGGAGCGCCTTTCTCAAAAGGACAGCCTCGAGGAGGGG
TA
GAGAAAGGCCCTGCAGCACTGAGGAAAGCTGGTCTGCTGGAAAAACTTAAAGAAACAGAGTATGACGT
G
AGAGACCACGGGGACCTGGCCTTTGTTGATGTCCCTAATGACAGCTCCTTTCAAATTGTGAAGAACCCA
CGG
TCTGTGGGGAAAGCCAATGAAGAGCTGGCTGGTGTGGTGGCAGAGGTCCAGAAGAATGGAAGAGTCA
GT
GTGGTGCTGGGTGGAGACCACAGTCTGGCAGTTGGAAGCATCTCTGGCCACGCCAGGGTCCACCCTGA
C
CTATGTGTCATTTGGGTGGATGCTCACACTGACATCAACACTCCCCTGACAACCAGCTCTGGGAATCTG
CAT
GGGCAACCTGTGTCCTTTCTCCTGAAGGAACTGAAAGGAAAGTTCCCAGATGTACCAGGATTCTCCT
GG
GTGACTCCCTGCATATCTGCCAAAGACATCGTGTACATTGGCTTGCGAGACGTAGACCCTGGGGAACA
C
TATATAATAAAAACTCTGGGAATTAAGTATTTCTCCATGACTGAAGTAGACAAGCTGGGGATTGGCAAG
GTG
ATGGAAGAGACCTTCAGCTACCTGCTGGGAAGGAAGAAAAGGCCGATTCACCTGAGCTTTGATGTCG
AC
GGGCTGGACCCAGCATTCACCCCGGCGACCGGCACCCCGGTTCTGGGAGGCCTATCTTACAGAGAAGG
T
CTCTACATCACAGAAGAAATTTACAAGACAGGGCTCCTTTCAGGACTAGATATCATGGAAGTGAACCCA
ACT
CTTGGGAAGACAGCAGAGGAGGTGAAGAGTACTGTGAACACGGCAGTGGCTTTAACCTTGGCTTGCT
TC
GGAACTCAACGGGAGGGTAACCATAAGCCAGGGACTGACTACCTTAAACCACCTAAGTGA


Translation (323 aa):
MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNP
R
SVGKANEELAGVVAEVQKNGRVSVVLGGDH
SLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNL
H
GQPVSFLLKELKGK
FPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK
V
MEETFSYLLG
RKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNP
T
LGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser