NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48435.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48435.1 Public Mus musculus 1 Rxrg 21 106 86 CCDS HistoryNCBI Gene:20183Re-query CCDS DB by CCDS ID:48435.1Re-query CCDS DB by GeneID:20183See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48435.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111380 ENSMUSP00000107011 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111380Link to Ensembl Protein Viewer:ENSMUSP00000107011Re-query CCDS DB by Nucleotide ID:ENSMUST00000111380Re-query CCDS DB by Protein ID:ENSMUSP00000107011
Original member Current member EBI,WTSI OTTMUST00000054047 OTTMUSP00000025740 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054047Link to Vega Protein Viewer:OTTMUSP00000025740Re-query CCDS DB by Nucleotide ID:OTTMUST00000054047Re-query CCDS DB by Protein ID:OTTMUSP00000025740
Original member Current member NCBI NM_001159731.1 NP_001153203.1 Accepted alive Link to Nucleotide Sequence:NM_001159731.1Link to Protein Sequence:NP_001153203.1Re-query CCDS DB by Nucleotide ID:NM_001159731Re-query CCDS DB by Protein ID:NP_001153203Link to BLAST:NP_001153203.1

Chromosomal Locations for CCDS 48435.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 167625000 167625072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167627292 167627471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167630962 167631122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167631230 167631359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167632515 167632647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167634435 167634526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167635700 167635805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 167639126 167639273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1023 nt):
ATGAACTACCCATCCACCAGCCCTGGGTCTCTGGTGAAACACATCTGTGCCATCTGTGGGGACAGATCCT
CA
GGGAAGCACTACGGTGTGTACAGCTGTGAAGGTTGCAAAGGCTTCTTCAAAAGGACCATCAGGAAAGA
T
CTCATCTACACCTGTCGGGATAACAAAGATTGTCTCATCGACAAGCGCCAGCGCAACCGCTGCCAGTAC
TGT
CGCTACCAGAAGTGCCTGGTCATGGGCATGAAGCGGGAAGCTGTGCAAGAAGAAAGGCAGAGGAGCC
GA
GAGCGAGCAGAGAGTGAGGCAGAATGTGCCAGTAGTAGCCACGAAGACATGCCCGTGGAGAGGATTCT
A
GAAGCCGAACTTGCTGTGGAACCAAAGACAGAATCCTACGGTGACATGAACGTGGAGAACTCAACAAAT
GAC
CCTGTTACCAACATATGCCATGCTGCAGATAAGCAACTTTTCACCCTCGTTGAGTGGGCCAAACGCA
TC
CCCCACTTCTCAGATCTCACCTTGGAGGACCAGGTCATTCTACTCCGGGCAGGGTGGAATGAACTGCT
C
ATTGCCTCCTTCTCCCACCGCTCGGTTTCCGTCCAGGATGGCATCCTGCTGGCCACGGGCCTCCACGTG
CAC
AGGAGCAGCGCTCACAGCGCGGGAGTCGGCTCCATCTTCGACAGAGTCCTTACAGAGTTGGTGTCCA
AG
ATGAAAGACATGCAGATGGATAAGTCAGAGCTGGGGTGCCTACGGGCCATCGTGCTGTTTAACCCAGA
T
GCCAAGGGTTTATCCAACCCCTCTGAGGTGGAGACTCTTCGAGAGAAGGTTTATGCCACCCTGGAGGCC
TAT
ACCAAGCAGAAGTATCCGGAACAGCCAGGCAGGTTTGCCAAGCTTCTGCTGCGTCTCCCTGCTCTGC
GC
TCCATCGGCTTGAAATGCCTGGAACACCTCTTCTTCTTCAAGCTCATTGGAGACACTCCCATCGACAG
C
TTCCTCATGGAGATGTTGGAGACCCCACTGCAGATCACCTGA


Translation (340 aa):
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQY
C
RYQKCLVMGMKRE
AVQEERQRSRERAESEAECASSSHEDMPVERILEAELAVEPKTESYGDMNVENSTN
D
PVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRA
GWNELLIASFSHRSVSVQDGILLATGLHV
H
RSSAHSAGVGSIFD
RVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEA
Y
TKQKYPEQPG
RFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser