NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48377.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48377.1 Public Mus musculus 1 Tnnt2 21 106 86 CCDS HistoryNCBI Gene:21956Re-query CCDS DB by CCDS ID:48377.1Re-query CCDS DB by GeneID:21956See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48377.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112087 ENSMUSP00000107717 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112087Link to Ensembl Protein Viewer:ENSMUSP00000107717Re-query CCDS DB by Nucleotide ID:ENSMUST00000112087Re-query CCDS DB by Protein ID:ENSMUSP00000107717
Original member Current member EBI,WTSI OTTMUST00000126907 OTTMUSP00000068593 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000126907Link to Vega Protein Viewer:OTTMUSP00000068593Re-query CCDS DB by Nucleotide ID:OTTMUST00000126907Re-query CCDS DB by Protein ID:OTTMUSP00000068593
Original member Current member NCBI NM_001130176.1 NP_001123648.1 Accepted alive Link to Nucleotide Sequence:NM_001130176.1Link to Protein Sequence:NP_001123648.1Re-query CCDS DB by Nucleotide ID:NM_001130176Re-query CCDS DB by Protein ID:NP_001123648Link to BLAST:NP_001123648.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001123648.1 301 P50752-1 301 100% 0 0

Chromosomal Locations for CCDS 48377.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 135840875 135840912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135841901 135841911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135843785 135843814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135845555 135845644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135845898 135845933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135846722 135846755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135847709 135847772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135847981 135848097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135848811 135848888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135849350 135849460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135850379 135850387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135850711 135850820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135851352 135851442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135851696 135851736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 135852027 135852072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (906 nt):
ATGTCTGACGCCGAGGAGGTGGTGGAGGAGTACGAGGAGGAACAGGAAGAGGAAGACTGGAGTGAAGAAG
AG
GAGGACGAGCAAGAGGAGGCAGTGGAGGAGGAGGAGGCTGGTGGGGCTGAACCTGAGCCTGAGGGTGA
G
GCTGAGACAGAGGAGGCCAACGTAGAAGAGGTTGGTCCTGATGAAGAAGCCAAAGATGCTGAAGAAGGT
CCA
GTAGAGGACACCAAACCCAAGCCCAGCAGGCTCTTCATGCCCAACTTGGTGCCACCCAAGATCCCCG
AT
GGAGAGAGAGTGGACTTTGATGACATCCACAGGAAGCGCGTGGAGAAGGACCTGAATGAGCTACAGAC
T
CTGATCGAGGCTCACTTCGAGAACAGGAAGAAGGAGGAAGAGGAGCTGATTTCCCTCAAAGACAGGATC
GAA
AAGCGTCGGGCAGAGCGGGCCGAGCAGCAGCGTATTCGCAATGAGCGGGAGAAGGAAAGGCAGAACC
GC
CTGGCTGAAGAGAGGGCCCGGCGTGAGGAGGAGGAGAACAGGAGGAAGGCTGAGGATGAGGCCCGGAA
G
AAGAAGGCTCTGTCCAACATGATGCACTTTGGAGGGTACATCCAGAAGCAAGCTCAGACAGAGCGGAAG
AGT
GGGAAGAGACAGACAGAGAGAGAGAAGAAGAAGAAGATCCTGGCAGAGAGGAGGAAGGCGCTGGCCA
TC
GACCACCTGAATGAAGACCAACTGAGAGAGAAGGCCAAGGAGCTGTGGCAGAGTATTCACAACCTGGA
G
GCTGAGAAGTTCGACCTGCAGGAAAAGTTCAAGCAGCAGAAATACGAAATCAACGTTCTGCGAAACCGG
ATC
AATGACAACCAGAAAGTCTCCAAAACTCGTGGGAAGGCCAAAGTCACCGGGCGTTGGAAATAG


Translation (301 aa):
MSDAEEVVEEYEEEQEEEDWSEEEEDEQEEAVEEEEAGGAEPEPEGEAETEEANVEEVGPDEEAKDAEEG
P
VEDTKPKP
SRLFMPNLVPPKIPDGERVDFDDIHRKRVEKDLNELQTLIEAHFENRKKEEEELISLKDRI
E
KRRAERAEQQRIRNEREKERQNRLA
EERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERK
S
GKRQTEREKKKKILAERRKALAIDHLNEDQL
REKAKELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNR
I
NDNQK
VSKTRGKAKVTGRWK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser