NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48326.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48326.1 Public Mus musculus 1 Kif1a 21 106 86 CCDS HistoryNCBI Gene:16560Re-query CCDS DB by CCDS ID:48326.1Re-query CCDS DB by GeneID:16560See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48326.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000171556 ENSMUSP00000130717 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171556Link to Ensembl Protein Viewer:ENSMUSP00000130717Re-query CCDS DB by Nucleotide ID:ENSMUST00000171556Re-query CCDS DB by Protein ID:ENSMUSP00000130717
Original member Current member EBI,WTSI OTTMUST00000124565 OTTMUSP00000067753 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000124565Link to Vega Protein Viewer:OTTMUSP00000067753Re-query CCDS DB by Nucleotide ID:OTTMUST00000124565Re-query CCDS DB by Protein ID:OTTMUSP00000067753
Original member Current member NCBI NM_001110315.2 NP_001103785.1 Accepted alive Link to Nucleotide Sequence:NM_001110315.2Link to Protein Sequence:NP_001103785.1Re-query CCDS DB by Nucleotide ID:NM_001110315Re-query CCDS DB by Protein ID:NP_001103785Link to BLAST:NP_001103785.1

Chromosomal Locations for CCDS 48326.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 93018457 93018499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93018952 93019070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93019807 93019999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93020458 93020610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93021213 93021337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93021726 93021803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93022321 93022521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93022926 93023071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93023459 93023520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93024579 93024712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93025621 93025735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93036846 93036951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93039035 93039119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93039217 93039283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93039745 93039853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93040619 93040674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93041574 93041692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93042085 93042175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93042343 93042511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93042616 93042754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93043589 93043674 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93046652 93046770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93052424 93052561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93054260 93054438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93054816 93054964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93055685 93055778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93055957 93056029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93056100 93056280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93058814 93058897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93060197 93060303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93060738 93060817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93062500 93062575 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93062867 93062946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93064149 93064282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93066047 93066189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93067056 93067134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93068485 93068560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93072308 93072325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93073039 93073104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93073808 93073885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93074956 93075067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93076151 93076329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93077042 93077107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93077688 93077867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93078761 93078837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 93082316 93082421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5070 nt):
ATGGCCGGGGCCTCTGTGAAGGTGGCGGTGCGTGTCCGCCCCTTCAACTCCCGGGAAATGAGCCGAGACT
CC
AAGTGCATCATTCAGATGTCTGGAAGCACCACCACTATTGTCAACCCCAAACAGCCCAAGGAGACACC
C
AAGAGCTTCAGCTTTGATTACTCCTACTGGTCACATACCTCGCCGGAGGACATCAACTATGCCTCTCAG
AAG
CAGGTCTACAGGGACATTGGGGAAGAGATGCTACAGCATGCCTTTGAGGGCTACAATGTGTGCATCT
TT
GCCTATGGGCAGACGGGGGCCGGCAAGTCCTACACCATGATGGGGAAACAGGAGAAGGACCAGCAAGG
C
ATCATTCCACAGCTCTGCGAAGACCTCTTCTCTCGAATCAACGACACCACCAACGACAACATGTCCTAC
TCT
GTGGAGGTCAGCTACATGGAGATTTACTGTGAGCGAGTCCGTGACCTCCTGAACCCCAAGAACAAAG
GC
AACCTGCGTGTGAGGGAGCACCCTCTGCTGGGGCCTTATGTGGAGGACCTCTCCAAGCTGGCTGTAAC
C
TCCTACAATGACATCCAGGACCTCATGGACTCAGGGAACAAGGCCAGGACTGTGGCGGCCACAAACATG
AAT
GAGACCAGCAGCCGTTCTCACGCAGTCTTCAACATCATCTTTACCCAGAAGCGCCATGATGCAGAGA
CC
AACATCACCACAGAGAAAGTGAGCAAAATCAGCCTGGTGGACCTGGCAGGCAGTGAACGAGCCGACTC
C
ACAGGAGCCAAGGGCACGCGACTCAAGGAGGGGGCCAACATCAACAAGTCTTTGACCACCCTGGGAAAG
GTC
ATCTCTGCTCTGGCTGAAATGGACTCTGGACCCAACAAGAACAAGAAAAAGAAGAAGACAGATTTCA
TC
CCTTACCGAGACTCCGTATTGACATGGCTTCTCCGGGAAAACCTCGGTGGCAACTCAAGGACAGCCAT
G
GTGGCAGCCCTGAGCCCTGCGGACATCAACTATGATGAGACCCTCAGCACACTGAGATATGCAGATCGG
GCC
AAACAAATCCGCTGCAATGCCATCATCAATGAAGACCCCAACAACAAGCTGATTAGAGAACTGAAGG
AT
GAGGTGACCAGGCTGAGAGACCTGCTGTATGCCCAAGGTCTTGGCGATATCACTGACATGACCAATGC
C
CTGGTGGGCATGAGCCCCTCATCTTCACTCTCAGCCCTGTCCAGCCGTGCAGCCTCTGTGTCCAGTCTC
CAT
GAGCGCATCTTGTTTGCTCCAGGCAGCGAGGAGGCTATTGAAAGGCTGAAGGAAACAGAGAAGATCA
TT
GCTGAACTCAATGAGACCTGGGAGGAGAAGCTGCGGCGGACAGAAGCCATCCGGATGGAGAGGGAAGC
C
TTGCTGGCTGAGATGGGTGTGGCCATGAGGGAAGATGGTGGTACCTTGGGTGTGTTTTCTCCCAAAAAG
ACT
CCTCATCTTGTCAACCTGAATGAGGACCCTTTGATGTCCGAATGCCTCCTTTACTACATCAAAGATG
GC
GTCACCAGAGTGGGCAGAGAAGATGCAGAGAGGCGGCAAGACATTGTCCTGAGTGGACACTTCATCAA
A
GAGGAGCACTGCATCTTCCGGAGTGACTCCCGAGGAGGCGGAGAAGCTGTGGTGACCCTGGAGCCCTGT
GAA
GGAGCAGACACATATGTCAACGGCAAGAAAGTCACTGAGCCCAGCATCCTACGGTCAGGAAACCGCA
TC
ATCATGGGAAAAAGCCACGTGTTCCGGTTTAACCACCCTGAGCAGGCCCGTCAGGAGCGTGAGCGAAC
A
CCTTGTGCAGAGACACCTGCTGAGCCAGTGGACTGGGCCTTTGCCCAGCGGGAACTGCTGGAGAAGCAA
GGC
ATTGACATGAAGCAGGAGATGGAGCAGAGGCTCCAGGAGTTGGAGGACCAGTACCGGAGGGAGCGGG
AG
GAGGCCACATACCTTCTGGAGCAGCAGAGGCTGGACTATGAGAGTAAGCTGGAGGCCCTACAGAAACA
G
ATGGACTCCAGGTACTACCCAGAGGTGAACGAGGAGGAAGAAGAGCCAGAGGATGAAGTCCAATGGACA
GAA
CGAGAATGTGAGCTGGCATTGTGGGCCTTCCGGAAGTGGAAGTGGTACCAGTTTACTTCTCTGCGGG
AC
CTGCTGTGGGGCAATGCCATCTTCCTGAAGGAGGCCAACGCCATCAGTGTGGAGCTAAAGAAGAAGGT
C
CAGTTCCAGTTTGTCCTCCTCACGGACACCCTGTACTCCCCACTGCCGCCAGACCTACTGCCCCCAGAA
GCC
GCCAAAGACCGAGAGACACGACCCTTCCCCAGGACCATTGTGGCAGTGGAGGTCCAGGACCAGAAGA
AT
GGGGCCACCCACTACTGGACACTGGAGAAACTCAGGCAACGCCTGGACCTGATGCGGGAAATGTACGA
C
AGGGCTGCAGAGGTTCCCTCCAGCGTCGTTGAGGACTGTGACAACGTGGTGACCGGCGGGGACCCCTTC
TAT
GACCGCTTCCCCTGGTTCCGACTGGTGGGCAGGGCCTTCGTATACCTGAGCAACCTGCTGTACCCTG
TG
CCCCTGGTGCACCGAGTGGCAATCGTCAGCGAAAAGGGAGAGGTGAAAGGCTTCCTCCGTGTGGCGGT
G
CAGGCCATCTCAGCTGATGAAGAGGCTCCGGATTATGGCTCGGGTGTCCGTCAGTCAGGAACTGCTAAA
ATC
TCCTTTGATGACCAGCATTTTGAAAAGTTCCAATCTGAGTCCTGCCCTGTGGTGGGGATGTCCCGCT
CA
GGAACTTCCCAAGAGGAGCTGCGCATTGTAGAAGGCCAGGGTCAGGGGGCTGATGCTGGGCCTTCAGC
T
GATGAAGTTAACAACAACACCTGTTCAGCTGTGCCTCCTGAAGGCCTCATGGATAGCCCAGAGAAGGCT
GCC
CTGGATGGGCCTCTGGACACAGCCCTGGACCACCTCCGTCTAGGCAGTACCTTCACCTTCCGGGTGA
CA
GTCCTGCAGGCGTCCAGTATCTCTGCTGAATACGCTGACATCTTCTGCCAGTTCAACTTTATCCACCG
C
CACGATGAGGCCTTCTCCACTGAACCCCTGAAGAACACTGGCAGAGGACCCCCTCTTGGCTTCTACCAT
GTC
CAAAATATTGCGGTAGAGGTGACCAAGTCCTTCATCGAATACATCAAGAGCCAGCCCATTGTGTTCG
AG
GTCTTTGGGCACTACCAGCAGCACCCGTTCCCACCTCTTTGCAAGGATGTCCTCAGCCCCCTGAGACC
C
TCACGTCGCCACTTCCCCAGGGTCATGCCGTTATCCAAGCCAGTGCCCGCCACTAAGCTCAGCACGATG
ACA
CGGCCTTCCCCAGGTCCCTGCCATTGCAAGTATGACCTGCTGGTCTACTTCGAGATCTGCGAGCTGG
AA
GCCAATGGCGATTACATCCCTGCTGTGGTGGACCACCGTGGTGGCATGCCGTGCATGGGGACTTTCCT
T
CTCCATCAGGGCATCCAGAGACGGATAACTGTGACACTGTTACATGAGACAGGAAGCCACATCCGCTGG
AAG
GAAGTGCGCGAGCTAGTTGTGGGTCGCATCCGAAACACCCCAGAAACTGACGAAGCTCTGATTGACC
CC
AACATCTTGTCCCTCAACATCCTCTCATCAGGATACGTCCATCCAGCCCAGGATGACCGGACCTTCTA
C
CAGTTTGAAGCAGCCTGGGACAGTTCCATGCATAACTCTCTCCTGCTGAATCGTGTCACCCCTTACCGG
GAG
AAAATCTACATGACGCTCTCTGCCTACATTGAGATGGAGAACTGTACCCAGCCAGCTGTCATCACCA
AG
GACTTCTGCATGGTTTTCTACTCTCGGGACGCCAAGCTACCCGCCTCACGCTCCATTCGCAACCTGTT
T
GGCAGTGGCAGCCTGCGGGCCACAGAAGGCAACCGTGTGACTGGTGTGTATGAGCTCAGCCTTTGCCAC
GTG
GCCGACGCAGGCAGCCCAGGGATGCAGCGTCGGCGCCGGCGGGTGCTGGACACATCAGTAGCCTATG
TC
CGGGGTGAGGAGAACCTGGCTGGCTGGAGGCCCCGAAGTGACAGCCTGATCCTAGATCACCAGTGGGA
A
CTGGAGAAACTGAGCCTCTTACAGGAGGTGGAAAAGACCAGGCACTACCTGCTCCTTCGGGAGAAGCTG
GAG
ACGACCCAGCGCCCTGGCCCTGAGGTGCTGTCCCCAGCCTCCAGTGAGGACTCTGAGTCCCGTAGTT
CT
TCAGGTGCCTCTTCCCCATTGTCAGCCGAGGGTCAGCCGTCACCTCTGGAGGCTCCCAACGAGAGGCA
G
AGGGAGCTGGCTGTCAAGTGCTTACGACTCCTCATGCACACATTCAACAGGGAATACACCCACAGCCAC
GTC
TGTATCAGCGCCAGCGAGAGCAAGCTCTCTGAGATGTCTGTCACCCTGATGCGGGACCCATCCATGT
CC
CCTCTGGGTGCTGCTACACTCACTCCCTCCTCCACTTGCCCCTCTCTGATCGAAGGACGATACGGTGC
C
ACTGACGTGAGGACCCCCCAGCCCTGCTCCCGGCCCGCCAGCCCAGAGCCCGAGCTCCTGCCAGAACTT
GAC
TCTAAGAAGACTCCCTCCCCTGTTCGGGCAACAGAGACAGAGAAGGAGCCCCAGCGACTGCTGGTCC
CT
GACATCCAAGAGATCCGAGTCAGCCCAATCGTCTCCAAGAAGGGATACCTGCATTTCCTGGAGCCACA
C
ACGGCTGGCTGGGCCAAGCGCTTTGTGGTGGTGAGGCGTCCCTACGCCTACATGTACAACAGTGACAAG
GAC
ACGGTGGAGAGATTTGTGCTCAACCTCTCCACTGCGCAGGTGGAGTACAGCGAGGACCAGCAGGCCA
TG
CTCAAGACACCCAACACATTCGCTGTGTGCACGGAGCACCGAGGCATCCTGCTGCAGGCCAACAGTGA
C
AAGGACATGCACGACTGGCTGTATGCCTTCAACCCGCTCCTGGCTGGGACCATCCGGTCCAAGCTCTCT
CGA
AGGAGATCTGCGCAGATGCGGGTCTGA


Translation (1689 aa):
MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQ
K
QVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQ
LCEDLFSRINDTTNDNMSY
S
VE
VSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNM
N
ETSSRSHAVFNIIFTQKRHDAETNITTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGK
V
ISALAEM
DSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADR
A
KQIRCNAIINEDPNNKLIRELKDEVTRLRDLLYAQGLGDITD
MTNALVGMSPSSSLSALSSRAASVSSL
H
ERILFAPGSEEAIERLK
ETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKK
T
PHLVNLNEDPLMSECLLYYIKDGVT
RVGREDAERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPC
E
GADTYVNGKKVTEPSILRS
GNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQ
G
IDMKQEMEQ
RLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQMDSRYYPEVNEEEEEPEDEVQWT
E
RECELALWAFRKWKWYQFTSLRDLLWGNAIFLKEANAISVELKKK
VQFQFVLLTDTLYSPLPPDLLPPE
A
AKDRETRPFPRTIVAVEVQDQKNGATHYWTLEKL
RQRLDLMREMYDRAAEVPSSVVEDCDNVVTGGDPF
Y
DRFPWFRLVG
RAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAK
I
SFDDQHFEK
FQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNNNTCSAVPPEGLMDSPEKA
A
LDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQF
NFIHRHDEAFSTEPLKNTGRGPPLGFYH
V
QN
IAVEVTKSFIEYIKSQPIVFEVFGHYQQHPFPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTM
T
RPSPGPCHCKYDLLVYFEICELEANG
DYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRW
K
EVRELVV
GRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYR
E
KIYMTLSAYIE
MENCTQPAVITKDFCMVFYSRDAKLPASRSIRNLFGSGSLRATEGNRVTGVYELSLCH
V
ADAGSP
GMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL
E
TTQRPGPEVLSPASSEDSESRSSSGASSPLSAEGQPSPLEAPNERQRELAVK
CLRLLMHTFNREYTHSH
V
CISASESK
LSEMSVTLMRDPSMSPLGAATLTPSSTCPSLIEGRYGATDVRTPQPCSRPASPEPELLPEL
D
SKKTPSPVRATETEKEPQRLLVPDIQEIRV
SPIVSKKGYLHFLEPHTAGWAKRFVVVRRPYAYMYNSDK
D
TVERFVLNLSTAQVEYSEDQQAMLK
TPNTFAVCTEHRGILLQANSDKDMHDWLYAFNPLLAGTIRSKLS
R
RRSAQMRV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser