NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48230.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48230.1 Public Mus musculus 1 Kcnq5 21 106 86 CCDS HistoryNCBI Gene:226922Re-query CCDS DB by CCDS ID:48230.1Re-query CCDS DB by GeneID:226922See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48230.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000115300 ENSMUSP00000110955 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115300Link to Ensembl Protein Viewer:ENSMUSP00000110955Re-query CCDS DB by Nucleotide ID:ENSMUST00000115300Re-query CCDS DB by Protein ID:ENSMUSP00000110955
Original member Current member EBI,WTSI OTTMUST00000047088 OTTMUSP00000021274 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000047088Link to Vega Protein Viewer:OTTMUSP00000021274Re-query CCDS DB by Nucleotide ID:OTTMUST00000047088Re-query CCDS DB by Protein ID:OTTMUSP00000021274
Original member Current member NCBI NM_001160139.1 NP_001153611.1 Accepted alive Link to Nucleotide Sequence:NM_001160139.1Link to Protein Sequence:NP_001153611.1Re-query CCDS DB by Nucleotide ID:NM_001160139Re-query CCDS DB by Protein ID:NP_001153611Link to BLAST:NP_001153611.1

Chromosomal Locations for CCDS 48230.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 21402163 21403125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21404932 21405058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21405793 21405924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21424049 21424157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21457404 21457624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21461551 21461607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21466383 21466409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21469470 21469564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21479374 21479469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21487223 21487333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21505300 21505425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21505684 21505859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21535061 21535187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21593524 21593614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 21961181 21961581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2859 nt):
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGTGCCGCCGGGCTCTGGGTGAGGAGCGGCGCGGCGG
CG
GCGGCAGGCGCGGGTGGGGGGCGCCCGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGCGGCAGGGT
G
CTGCTGAACTCGGCGGCCGCCAGGGGCGACGGCCTGCTGTTGCTCGGCACCCGCGCGGCGGCGCTCGGC
GGA
GGCGGCGGCGGCTTGAGAGAGAGCCGCCGGGGCAAGCAGGGGGCCCGAATGAGCCTGCTGGGGAAGC
CG
CTCTCCTACACCAGCAGCCAGAGCTGTCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTATCTGTA
C
AACGTGCTGGAGCGACCCCGCGGCTGGGCGTTCGTCTACCACGCGTTCGTTTTTCTCCTTGTGTTTGGT
TGC
TTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCATACAAAATTGGCTTCAAGTTGCCTCTTAATTC
TG
GAGTTCGTGATGATCGTTGTCTTTGGCTTGGAGTTCATCATTCGAATCTGGTCTGCAGGTTGCTGTTG
T
CGTTATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAACCATTCTGTGTAATAGATACCATTGTT
CTC
ATCGCTTCAATAGCAGTTGTCTCTGCAAAAACTCAGGGTAATATTTTCGCCACGTCAGCGCTCAGAA
GT
CTCCGGTTCCTACAGATCCTGCGTATGGTGCGCATGGACAGAAGGGGAGGGACCTGGAAGCTGCTCGG
C
TCTGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCCTGGTACATTGGATTTCTGGTTCTTATTTTT
TCA
TCCTTCCTTGTCTATCTTGTGGAAAAGGATGCCAATAAAGAGTTTTCGACATATGCGGATGCTCTCT
GG
TGGGGCACAATCACACTGACAACCATTGGCTATGGAGACAAAACACCCCTAACGTGGCTGGGAAGACT
G
CTCTCTGCAGGCTTCGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCTGGCATTCTTGGCTCAGGT
TTT
GCATTAAAAGTACAGGAGCAGCACCGCCAGAAGCATTTTGAGAAAAGAAGGAACCCAGCTGCCAACC
TC
ATCCAGTGTGTCTGGCGTAGTTATGCAGCTGATGAAAAATCTGTTTCCATTGCAACCTGGAAGCCACA
T
CTGAAGGCCTTGCACACCTGCAGCCCTACCAAGAAAGAACAAGGGGAGGCATCAAGCAGTAAGTTCTGT
AGT
AATAAGCAGAAGTTCTTCAGAGTGTACACCTCACGGAAGCAGAGTCAGAAGCTGAGCTTTAAGGAGC
GA
GTGCGCATGGCTAGCCCAAGGGGCCAGAGCATTAAGAGCAGACAAGCATCAGTAGGTGACAGGAGATC
C
CCGAGCACTGACATCACTGCCGAGGGCAGCCCCACCAAAGTCCAGAAGAGTTGGAGCTTCAACGACCGA
ACC
CGCTTCAGGCCCTCACTACGGCTCAAGAGTTCCCAGCCAAAGCCAGTGATAGACGCCGACACAGCCC
TT
GGCATTGATGATGTGTATGATGAGAAAGGATGCCAGTGTGACGTCTCTGTGGAGGACCTCACCCCACC
A
CTTAAAACCGTCATCCGAGCAATCAGAATTATGAAGTTTCATGTTGCAAAGCGGAAGTTTAAGGAAACA
TTA
CGCCCATATGATGTAAAAGATGTCATTGAACAATACTCTGCTGGTCACCTGGACATGCTTTGTAGAA
TA
AAAAGCCTTCAGACACGCGTTGATCAAATTCTTGGAAAAGGACAAATGACGTCAGATAAGAAGAGCCG
A
GAGAAAATAACAGCAGAACACGAGACAACAGATGACCCCAGCATGCTCGCCCGGGTTGTGAAGGTTGAG
AAA
CAGGTCCAGTCCATCGAATCCAAGCTGGACTGCCTGCTGGATATCTATCAACAGGTCCTCCGGAAAG
GC
TCTGCCTCCGCCCTCACTCTGGCATCCTTTCAGATCCCGCCTTTTGAATGTGAACAGACCTCTGACTA
T
CAAAGTCCTGTGGATAGCAAAGACCTGTCTGGCTCAGCACAAAACAGCGGCTGTTTAACGAGGTCAGCC
AGT
GCCAACATCTCAAGAGGCCTGCAGTTCATCCTAACACCAAATGAGTTCAGTGCTCAGACTTTCTATG
CG
CTTAGCCCTACTATGCACAGCCAAGCTACCCAGGTACCCATGAGTCAAAATGACGGCTCCTCCGTGGT
A
GCCACCAATAACATTGCAAACCAAATAAGCGCCGCACCCAAGCCAGCAGCCCCAACAACTTTACAGATC
CCT
CCTCCTCTCTCGGCCATCAAGCACTTGTCCAGGCCAGAACCTCTGCTCTCAAACCCCACCGGCTTAC
AA
GAGAGTATTTCTGATGTCACCACCTGCCTTGTTGCCTCCAAGGAAAGTGTTCAGTTTGCACAGTCAAA
C
CTGACCAAGGACCGTTCCCTGAGGAAAAGTTTCGACATGGGAGGAGAAACTCTGTTGTCTGTCCGCCCC
ATG
GTGCCCAAGGATTTGGGCAAATCTCTGTCTGTACAAAACCTGATCAGGTCGACAGAAGAACTGAACT
TA
CAGTTTTCAGGCAGCGAGTCAAGCGGCTCTCGAGGCAGTCAAGATTTTTATCCCAAGTGGAGAGAATC
C
AAATTGTTTATAACTGATGAGGAGGTCGGTGCCGAAGAGACAGAAACAGATACTTTTGACGGCACCCCA
CCG
CCTGCGGGGGAGGCTGCTTTCTCATCAGACTCTCTAAGGACTGGAAGGTCACGGTCATCTCAGAACA
TT
TGTAAGACAGGAGACAGTACAGACGCCCTCAGTTTGCCTCACGTCAAACTGAACTAA


Translation (952 aa):
MPRHHAGGEEGGAAGLWVRSGAAAAAGAGGGRPGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAAALG
G
GGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFVYHAF
VFLLVFG
C
LILSVFSTIPEHTKLASSCLLIL
EFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIV
L
IASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSK
ELITAWYIGFLVLIF
S
SFLVYLVEKDANKEFSTYADALWWGT
ITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSG
F
ALKVQEQHRQKHFEKRRNPAANLIQ
CVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSKFC
S
NKQKFFRVYTSRKQ
SQKLSFKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDR
T
RFRPSLRLKSSQPKPVID
ADTALGIDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKET
L
RPYDVKDVIEQYSAGHLDMLCRIKSLQT
RVDQILGKGQMTSDKKSREKITAEHETTDDPSMLARVVKVE
K
Q
VQSIESKLDCLLDIYQQVLRKGSASALTLASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLTRSA
S
ANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPMSQNDGSSVVATNNIANQISAAPKPAAPTTLQI
P
PPLSAIKHLSRPEPLLSNPTGLQESISDVTTCLVASKESVQFAQSNLTKDRSLRKSFDMGGETLLSVRP
M
VPKDLGKSLSVQNLIRSTEELNLQFSGSESSGSRGSQDFYPKWRESKLFITDEEVGAEETETDTFDGTP
P
PAGEAAFSSDSLRTGRSRSSQNICKTGDSTDALSLPHVKLN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser