NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41156.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41156.1 Public Mus musculus X Acsl4 21 106 86 CCDS HistoryNCBI Gene:50790Re-query CCDS DB by CCDS ID:41156.1Re-query CCDS DB by GeneID:50790See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41156.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112903 ENSMUSP00000108524 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112903Link to Ensembl Protein Viewer:ENSMUSP00000108524Re-query CCDS DB by Nucleotide ID:ENSMUST00000112903Re-query CCDS DB by Protein ID:ENSMUSP00000108524
Original member Current member EBI,WTSI ENSMUST00000112904 ENSMUSP00000108525 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112904Link to Ensembl Protein Viewer:ENSMUSP00000108525Re-query CCDS DB by Nucleotide ID:ENSMUST00000112904Re-query CCDS DB by Protein ID:ENSMUSP00000108525
Original member Current member EBI,WTSI OTTMUST00000045275 OTTMUSP00000020370 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045275Link to Vega Protein Viewer:OTTMUSP00000020370Re-query CCDS DB by Nucleotide ID:OTTMUST00000045275Re-query CCDS DB by Protein ID:OTTMUSP00000020370
Original member Current member EBI,WTSI OTTMUST00000045276 OTTMUSP00000020371 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045276Link to Vega Protein Viewer:OTTMUSP00000020371Re-query CCDS DB by Nucleotide ID:OTTMUST00000045276Re-query CCDS DB by Protein ID:OTTMUSP00000020371
Original member Current member NCBI NM_001033600.1 NP_001028772.1 Accepted alive Link to Nucleotide Sequence:NM_001033600.1Link to Protein Sequence:NP_001028772.1Re-query CCDS DB by Nucleotide ID:NM_001033600Re-query CCDS DB by Protein ID:NP_001028772Link to BLink:NP_001028772.1
Original member Current member NCBI NM_019477.3 NP_062350.3 Accepted alive Link to Nucleotide Sequence:NM_019477.3Link to Protein Sequence:NP_062350.3Re-query CCDS DB by Nucleotide ID:NM_019477Re-query CCDS DB by Protein ID:NP_062350Link to BLink:NP_062350.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028772.1 670 Q9QUJ7-2 670 100% 0 0
NP_062350.3 670 Q9QUJ7-2 670 100% 0 0

Chromosomal Locations for CCDS 41156.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 142320677 142320834 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142327976 142328133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142328848 142328962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142332192 142332383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142333670 142333744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142338884 142339056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142339950 142340089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142341335 142341406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142343074 142343197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142343307 142343457 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142345428 142345566 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142349002 142349111 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142350960 142351137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 142351379 142351606 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2013 nt):
ATGGCAAAGAGAATAAAAGCTAAGCCCACTTCAGACAAACCTGGAAGTCCATATCGCTCTGTCACACACT
TC
GACTCACTAGCTGTCATAGACATCCCTGGAGCAGATACTCTGGATAAATTATTTGACCATGCTGTAGC
C
AAATTTGGGAAGAAGGACAGCCTTGGAACCCGGGAGATCCTGAGTGAAGAAAATGAAATGCAGCCAAAT
GGA
AAGGTTTTTAAGAAGTTAATTCTTGGGAATTATAAATGGATAAACTATCTTGAAGTGAACTGCAGAG
TG
AATAACTTTGGAAGTGGCCTCACTGCATTGGGACTGAAACCAAAGAACACCATTGCCATTTTCTGTGA
G
ACCAGGGCAGAGTGGATGATTGCAGCACAGACTTGCTTTAAGTACAACTTTCCACTTGTGACTTTATAT
GCC
ACACTTGGCAGAGAAGCTGTAGTTCATGGATTAAATGAATCTGAGGCTTCCTATCTGATTACTAGTG
TT
GAGCTTCTGGAAAGCAAACTGAAGGCGGCCTTAGTAGATATCAATTGTGTTAAACATATCATTTATGT
G
GATAATAAGACTATCAATAGAGCAGAGTACCCTGAGGGGCTTGAAATTCACAGCATGCAATCAGTAGAG
GAG
CTGGGAGCCAAGCCAGAAAACTTGAGCGTTCCTCCAAGTAGACCAACCCCTTCAGACATGGCCATTG
TC
ATGTACACCAGTGGTTCTACGGGCCGCCCCAAGGGAGTGATGATGCATCATAGCAATTTGATTGCTGG
A
ATGACAGGCCAGTGTGAACGTATCCCTGGACTAGGACCGAAGGACACATATATTGGCTACTTACCTTTG
GCT
CATGTGCTGGAACTGACAGCAGAGATATCATGCTTTACCTATGGCTGTAGGATTGGATACTCTTCAC
CC
CTTACACTGTCTGACCAGTCCAGCAAAATCAAGAAGGGAAGCAAGGGTGATTGTACTGTACTGAAACC
C
ACACTTATGGCCGCTGTTCCGGAAATCATGGATAGAATTTATAAGAATGTTATGAGCAAGGTTCAAGAG
ATG
AATTATGTTCAGAAAACTCTATTTAAAATCGGGTATGATTACAAATTAGAGCAAATCAAGAAAGGCT
AT
GACGCCCCTCTTTGTAATCTGATACTGTTTAAAAAGGTGAAGGCTCTGCTGGGAGGGAATGTCCGCAT
G
ATGCTGTCTGGCGGCGCGCCACTGTCCCCTCAGACACACCGATTCATGAATGTCTGCTTCTGCTGCCCC
ATT
GGTCAGGGATATGGGCTGACAGAATCATGTGGTGCTGGAACAGTTACTGAAGTTACTGACTACACTA
CT
GGAAGAGTTGGAGCTCCTCTTATTTGCTGTGAAATTAAACTGAAAGACTGGCAGGAAGGTGGTTATAC
A
GTTCATGATAAGCCGAACCCCAGAGGTGAGATTGTGATCGGTGGCCAGAATATCTCCATGGGATATTTT
AAA
AACGAAGAGAAAACAGCAGAAGATTATTGTGTTGATGAAAATGGACAAAGGTGGTTTTGCACTGGCG
AT
ATTGGAGAATTCCATCCTGATGGATGCTTACAGATTATAGATCGTAAGAAAGATCTGGTAAAGTTACA
A
GCAGGAGAATATGTATCTCTTGGGAAAGTAGAAGCTGCACTGAAGAATTGTCCACTGATCGACAACATC
TGT
GCTTTTGCCAAAAGTGACCAGTCCTATGTGATCAGTTTTGTGGTTCCTAACCAGAAAAAGTTGACTC
TT
TTGGCACAACAGAAGGGGGTAGAAGGATCTTGGGTTGATATTTGCAATAATCCCGCCATGGAAGCTGA
A
ATACTGAAAGAAATTCGAGAAGCTGCAAATGCCATGAAATTGGAGCGATTTGAAATTCCGATCAAGGTT
CGG
TTAAGCCCAGAGCCATGGACCCCCGAGACTGGTTTGGTAACAGATGCCTTCAAGCTGAAAAGGAAGG
AG
TTGAAGAACCATTATCTCAAAGACATTGAGCGAATGTATGGGGGCAAATAA


Translation (670 aa):
MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVAKFGKKDSLGTREILSEENEMQPN
G
KVFKK
LILGNYKWINYLEVNCRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLY
A
TLGREAVVHGLNESEASYLITSVELLESKLK
AALVDINCVKHIIYVDNKTINRAEYPEGLEIHSMQSVE
E
LGAKPEN
LSVPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPL
A
HVLELTAEISCFTYGCRIGYSSPLTLSDQ
SSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQE
M
NYVQKTLFKIGYDYKLEQIKKGYDAPLCN
LILFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCP
I
GQGYGLTESCGAGTVTE
VTDYTTGRVGAPLICCEIKLKDWQEGGYTVHDKPNPRGEIVIGGQNISMGYF
K
NEEKTAEDYCVDENGQRWFCTGDIGEFHPDGCLQII
DRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNI
C
AFAK
SDQSYVISFVVPNQKKLTLLAQQKGVEGSWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKV
R
LSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGGK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser