NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41126.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41126.1 Public Mus musculus X Zmat1 21 106 86 CCDS HistoryNCBI Gene:215693Re-query CCDS DB by CCDS ID:41126.1Re-query CCDS DB by GeneID:215693See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 41126.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000064659 ENSMUSP00000066815 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064659Link to Ensembl Protein Viewer:ENSMUSP00000066815Re-query CCDS DB by Nucleotide ID:ENSMUST00000064659Re-query CCDS DB by Protein ID:ENSMUSP00000066815
Original member Current member NCBI NM_175446.3 NP_780655.2 Accepted alive Link to Nucleotide Sequence:NM_175446.3Link to Protein Sequence:NP_780655.2Re-query CCDS DB by Nucleotide ID:NM_175446Re-query CCDS DB by Protein ID:NP_780655Link to BLAST:NP_780655.2

Chromosomal Locations for CCDS 41126.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 134972697 134974026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 134977648 134977747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 134990564 134990629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 134992135 134992309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 134992397 134992498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 134993539 134993645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 135008911 135008974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1944 nt):
ATGGCGGCGGCGGGGAGGGGGGACAGTAGTTTTAAAGTAGACACCTGCCCTTGCCTCAGAGAAGATCCCA
CG
TGTGATGGACAAGAACAACCTGCGTATTTTACAGATAATTTTTGTAAACCATGTGGAGTGGTTCTACA
G
CATGAATCAGAAAGGATTTCACATTTTGAGAGTGAAATACATGCTCAAAATGTTAAGTTCTTTTTTCAA
ATG
CATGGAGAACAAAGCGAAGTGCCTGGTAGGAAAGTGAACATGCATGCTGGAAATTCTCAGGTGTGCT
CG
AGTGGAGAAGTCAACAGAAACAACTTTACTGATCTGCACAACATGAGTTTTGACTCCCTAGCTGCTGC
T
CCATCTCACTATGTGGGAAAGAGCCATTCTCCGACTCAGAACCAGTCACTGGAAGAACATGATCAAGTA
TCT
CCATCCACATGCTCACCAAAGATGGATGAACCCAATACTACTCCTGCACCTCCACCCTTCCTGAAGT
CT
GTTATTGTGAAGCCTCCTCCAGCATATAGAATGAGAACCTACGTATGCCATATCTGCAGTATCACCTT
T
ACATCTTTACATATGTTCCGGTCCCACATGCAAGGAACTGAACATCAAATTAAAGAATCTCATGTTATC
AAT
CAAGTGAAGAATTCAAAGAAAATGCAAGAGTCTTGTCAAGCTGAGTGTGGAGATGACATCAAAATGA
AG
AAATCTAGAGAACTAGAGCCCAAGGGTCATTTCAGGGAAATGGAGGATAATTACATGGAAGCCCAAGC
C
CATGAATACAGAGAAATGGTTGATTCTAGACCCAGACATAAAATGCTTGAACAAACACTTCCACTTGAA
AAT
TTCTGGGCACACCCAGGACCATACAATGATTCTAGAGCACTAGAAGAGCAGTTACCTCACAATTTAC
CA
GCAGAGTCAAAGACATATGACTCTTTCCAAGATGAACTTGAAGATTACATCAAAGGGCAGAAGGCCAG
A
GGACTTGATCCCAATACTAGTTTTAGACGGATGTCAGAAAGCTATAGGTATAGGGATCAGAGATACAGA
GAA
AGGGTTGATTCTGAACACAGACAGAGGCCTTGTGAGGAAAGATTTTCATTTGAGGCTCCACAGACCT
AC
CAGCAAGAATACAGTGCCTCCCCAGTGGAGGGCCAATCTCCTCACTGGTTACCATCTCATTCAAAGAG
G
AGAAATGATGATTTCCAAAATGAATTTGATGATTACAACAAGGTGCAGGAATCTAGAGAATCCGAGCCA
AAG
ACTTCTTTTAGAAGAATGGATAGCTCTTTTGAAACCCATAATTACGAAGAAATGGTTGACAGAAGAT
CC
AGTCATACAATGTTTGAGGAAGGACTCCCATGTGAGACTTTCCAGACTTACACAGATCCATACAGCAG
T
GCACAAGCAGTAGAAAACACGTTACCTCATTGCTTACCAGCTTATGAAAACCAACCGAGCCTAGATGCT
GAA
AGCCACTATCAGCTTACCACAGAGGAGTTCTCAGAAATGCCTGCTTCTCTGAGCCTCAGTCAACAAG
AA
GATAACCCTAGCTCATACAATGTAGACTATGACATTTACAAGCATCTGCCCTCAAATGACAATGCCAG
T
GCCCATGAAACAAGTCATAGAAGGCGACGTCAGAAGAGAAAACGACACCTGGAGGAAGGAAAAGAAAGA
CCA
GAGAAGGAACAGTCCAAACATAAAAGAAAAAGAAGCTATCAGGATAAAGATTTAGACAAAGACAAGC
TC
ATCAAGCAAAGTAAGAGAGAGGAAGATAAAGCTGGAGTCAGCTCTGAAAAAACCAAGCATCGAAGAAA
G
AAAAGAAAACATGAAACATCCTCAGAGAAAGAAGAACGTAAGCACAAAAAAGAGAAAAAGAAATCTGTT
GAA
GAGAGAACAGAAGAGGAAATCCTTTGGGATGAGTCAATTCTTGGGTTCTGA


Translation (647 aa):
MAAAGRGDSSFKVDTCPCLREDPTCDGQEQPAYFTDNFCKPCGVVLQHESERISHFESEIHAQNVKFFFQ
M
HGEQSEVPGRKVNMHAGNSQ
VCSSGEVNRNNFTDLHNMSFDSLAAAPSHYVGKSHSPTQNQSLEEHDQV
S
PSTCSPKM
DEPNTTPAPPPFLKSVIVKPPPAYRMRTYVCHICSITFTSLHMFRSHMQGTEHQIKESHVI
N
QVKNSKKMQESCQAECGDDIKMKKSRELEPKGHFREMEDNYMEAQAHEYREMVDSRPRHKMLEQTLPLE
N
FWAHPGPYNDSRALEEQLPHNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR
E
RVDSEHRQRPCEERFSFEAPQTYQQEYSASPVEGQSPHWLPSHSKRRNDDFQNEFDDYNKVQESRESEP
K
TSFRRMDSSFETHNYEEMVDRRSSHTMFEEGLPCETFQTYTDPYSSAQAVENTLPHCLPAYENQPSLDA
E
SHYQLTTEEFSEMPASLSLSQQEDNPSSYNVDYDIYKHLPSNDNASAHETSHRRRRQKRKRHLEEGKER
P
EKEQSKHKRKRSYQDKDLDKDKLIKQSKREEDKAGVSSEKTKHRRKKRKHETSSEKEERKHKKEKKKSV
E
ERTEEEILWDESILGF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser