NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40784.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40784.1 Public Mus musculus 9 Mlh1 21 106 86 CCDS HistoryNCBI Gene:17350Re-query CCDS DB by CCDS ID:40784.1Re-query CCDS DB by GeneID:17350See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40784.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035079 ENSMUSP00000035079 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035079Link to Ensembl Protein Viewer:ENSMUSP00000035079Re-query CCDS DB by Nucleotide ID:ENSMUST00000035079Re-query CCDS DB by Protein ID:ENSMUSP00000035079
Original member Current member EBI,WTSI OTTMUST00000078764 OTTMUSP00000041918 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078764Link to Vega Protein Viewer:OTTMUSP00000041918Re-query CCDS DB by Nucleotide ID:OTTMUST00000078764Re-query CCDS DB by Protein ID:OTTMUSP00000041918
Original member Current member NCBI NM_026810.2 NP_081086.2 Accepted alive Link to Nucleotide Sequence:NM_026810.2Link to Protein Sequence:NP_081086.2Re-query CCDS DB by Nucleotide ID:NM_026810Re-query CCDS DB by Protein ID:NP_081086Link to BLink:NP_081086.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081086.2 760 Q9JK91 760 100% 0 0

Chromosomal Locations for CCDS 40784.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 111228459 111228626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111229840 111229953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111230243 111230335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111230901 111231065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111233323 111233386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111235907 111236015 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111239723 111239871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111241225 111241607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111247250 111247403 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111249220 111249313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111252864 111252976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111255628 111255716 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111256093 111256135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111257400 111257491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111258489 111258561 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111261479 111261552 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111264867 111264965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111268218 111268308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 111271409 111271524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2283 nt):
ATGGCGTTTGTAGCAGGAGTTATTCGGCGTCTGGACGAGACGGTAGTGAACCGCATAGCGGCGGGGGAAG
TC
ATTCAGCGGCCGGCCAATGCTATCAAAGAGATGATAGAAAACTGTTTAGATGCAAAATCTACAAATAT
T
CAAGTGGTTGTTAAGGAAGGTGGCCTGAAGCTAATTCAGATCCAAGACAATGGCACTGGAATCAGGAAG
GAA
GATCTGGATATTGTGTGTGAGAGGTTCACTACGAGTAAACTGCAGACTTTTGAGGATTTAGCCAGTA
TT
TCTACCTATGGCTTTCGTGGTGAGGCATTGGCAAGCATAAGCCATGTGGCCCATGTCACTATTACAAC
C
AAAACAGCTGATGGGAAATGTGCGTACAGAGCAAGTTACTCAGATGGAAAGCTGCAAGCCCCTCCTAAA
CCC
TGTGCAGGCAACCAGGGCACCCTGATCACGGTGGAAGACCTTTTTTACAACATAATCACAAGGAGGA
AA
GCTTTAAAAAATCCAAGTGAAGAGTACGGAAAAATTTTGGAAGTTGTTGGCAGGTATTCAATACACAA
T
TCAGGCATTAGTTTCTCAGTTAAAAAACAAGGTGAGACAGTATCTGATGTCAGAACACTGCCCAATGCC
ACA
ACCGTGGACAACATTCGCTCCATCTTTGGAAATGCGGTTAGTCGAGAACTGATAGAAGTTGGGTGTG
AG
GATAAAACCCTAGCTTTCAAAATGAATGGCTATATATCGAATGCAAACTATTCAGTGAAGAAGTGCAT
T
TTCCTACTCTTCATCAACCACCGTCTGGTAGAATCAGCTGCCTTGAGAAAAGCCATTGAAACTGTATAT
GCA
GCATACTTGCCCAAAAACACACACCCATTCCTGTACCTCAGTTTGGAAATCAGCCCTCAGAACGTGG
AC
GTCAATGTACACCCCACCAAGCACGAAGTTCACTTTCTGCACGAGGAGAGCATTCTGCAGCGTGTGCA
G
CAGCACATTGAGAGCAAGCTGCTGGGCTCCAATTCCTCCAGGATGTATTTCACCCAGACCTTGCTTCCA
GGA
CTTGCTGGGCCTTCTGGGGAGGCAGCTAGACCCACGACAGGGGTGGCTTCCTCATCCACTAGTGGAA
GT
GGCGACAAGGTCTACGCTTACCAGATGGTCCGTACGGACTCCCGGGAGCAGAAGCTTGACGCCTTTCT
G
CAGCCTGTAAGCAGCCTTGGGCCCAGCCAGCCCCAGGACCCTGCCCCTGTCCGAGGGGCCAGGACGGAG
GGA
TCTCCTGAAAGGGCCACGCGGGAGGACGAGGAGATGCTTGCTCTCCCAGCCCCCGCTGAAGCAGCTG
CT
GAGAGTGAGAACTTGGAGAGGGAATCACTAATGGAGACTTCAGACGCAGCCCAGAAGGCGGCACCCAC
T
TCCAGTCCAGGAAGCTCCAGAAAGAGACATCGGGAGGACTCTGATGTGGAAATGGTGGAAAATGCTTCC
GGG
AAGGAAATGACAGCTGCTTGCTACCCCAGGAGGAGGATCATTAACCTCACCAGCGTCTTGAGTCTCC
AG
GAAGAGATTAGTGAGCGGTGCCATGAGACTCTCCGGGAGATGCTCCGTAACCATTCCTTTGTGGGCTG
T
GTGAATCCTCAGTGGGCCTTGGCACAGCACCAGACCAAGCTCTACCTCCTCAACACTACCAAGCTCAGT
GAA
GAGCTGTTCTACCAGATACTCATTTATGATTTTGCCAACTTTGGTGTTCTGAGGTTATCGGAACCAG
CG
CCACTCTTCGACCTGGCCATGCTGGCCTTAGACAGTCCTGAAAGTGGCTGGACAGAGGACGACGGCCC
G
AAGGAAGGGCTTGCAGAGTACATTGTTGAGTTTCTGAAGAAGAAAGCGGAGATGCTTGCAGACTATTTC
TCT
GTGGAGATCGATGAGGAAGGGAACCTGATTGGATTACCTCTTCTGATTGACAGCTATGTGCCACCTT
TG
GAGGGACTGCCTATCTTCATTCTTCGACTGGCCACTGAGGTGAATTGGGATGAAGAAAAGGAGTGTTT
T
GAAAGTCTCAGTAAAGAATGTGCTATGTTTTACTCCATTCGGAAGCAGTATATACTGGAGGAGTCGACC
CTC
TCAGGCCAGCAGAGTGACATGCCTGGCTCCACGTCAAAGCCCTGGAAGTGGACTGTGGAGCACATTA
TC
TATAAAGCCTTCCGCTCACACCTCCTACCTCCGAAGCATTTCACAGAAGATGGCAATGTCCTGCAGCT
T
GCCAACCTGCCAGATCTATACAAAGTCTTTGAGCGGTGTTAA


Translation (760 aa):
MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQIQDNGTGIRK
E
DLDIVCERFTTSKLQTFEDLASISTYGFRGE
ALASISHVAHVTITTKTADGKCAYRASYSDGKLQAPPK
P
CAGNQGTLIT
VEDLFYNIITRRKALKNPSEEYGKILEVVGRYSIHNSGISFSVKKQGETVSDVRTLPNA
T
TVDNIRSIFGNAVS
RELIEVGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESAALRKAIETVY
A
AYLPKNTHPFLYL
SLEISPQNVDVNVHPTKHEVHFLHEESILQRVQQHIESKLLGSNSSRMYFTQTLLP
G
LAGPSGEAARPTTGVASSSTSGSGDKVYAYQMVRTDSREQKLDAFLQPVSSLGPSQPQDPAPVRGARTE
G
SPERATREDEEMLALPAPAEAAAESENLERESLMETSDAAQKAAPTSSPGSS
RKRHREDSDVEMVENAS
G
KEMTAACYPRRRIINLTSVLSLQEEISERCHE
TLREMLRNHSFVGCVNPQWALAQHQTKLYLLNTTKLS
E
ELFYQILIYDFANFGVLRLS
EPAPLFDLAMLALDSPESGWTEDDGPKEGLAEYIVEFLKKKAEMLADYF
S
VEIDE
EGNLIGLPLLIDSYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYILEEST
L
SGQQ
SDMPGSTSKPWKWTVEHIIYKAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser