NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40742.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40742.1 Public Mus musculus 9 Ephb1 21 106 86 CCDS HistoryNCBI Gene:270190Re-query CCDS DB by CCDS ID:40742.1Re-query CCDS DB by GeneID:270190See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40742.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035129 ENSMUSP00000035129 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035129Link to Ensembl Protein Viewer:ENSMUSP00000035129Re-query CCDS DB by Nucleotide ID:ENSMUST00000035129Re-query CCDS DB by Protein ID:ENSMUSP00000035129
Original member Current member EBI,WTSI OTTMUST00000049888 OTTMUSP00000023194 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049888Link to Vega Protein Viewer:OTTMUSP00000023194Re-query CCDS DB by Nucleotide ID:OTTMUST00000049888Re-query CCDS DB by Protein ID:OTTMUSP00000023194
Original member Current member NCBI NM_173447.3 NP_775623.3 Accepted alive Link to Nucleotide Sequence:NM_173447.3Link to Protein Sequence:NP_775623.3Re-query CCDS DB by Nucleotide ID:NM_173447Re-query CCDS DB by Protein ID:NP_775623Link to BLAST:NP_775623.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_775623.3 984 Q8CBF3-1 984 100% 0 0

Chromosomal Locations for CCDS 40742.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 101923486 101923594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101927495 101927650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101929267 101929460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101936069 101936218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101963932 101964147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101971091 101971338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101984082 101984204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101995909 101995973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 101996780 101996888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102001705 102001867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102010017 102010141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102041012 102041347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102066871 102067026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102194774 102195455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102223388 102223452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 102354282 102354339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2955 nt):
ATGGCCCTGGATTGCTTGCTGCTCTTCCTCCTGGCATCTGCAGTGGCCGCGATGGAAGAGACATTGATGG
AC
ACAAGGACAGCCACTGCAGAGTTGGGATGGACGGCCAACCCTGCCTCTGGGTGGGAAGAAGTCAGTGG
C
TATGATGAAAACCTGAACACCATCCGTACTTACCAAGTGTGCAACGTCTTCGAACCCAACCAGAACAAC
TGG
CTGCTTACCACCTTTATCAACAGAAGGGGCGCCCATCGCATCTATACAGAGATGCGCTTCACTGTGA
GG
GACTGCAGCAGCCTTCCAAATGTCCCAGGCTCCTGCAAGGAGACCTTCAACTTGTACTACTATGAGAC
T
GACTCTGTGATTGCCACCAAGAAGTCAGCCTTCTGGTCTGAAGCCCCCTACCTCAAAGTGGACACCATT
GCT
GCAGATGAGAGCTTCTCCCAGGTGGATTTTGGGGGAAGGTTGATGAAAGTCAACACGGAAGTCAGGA
GC
TTTGGGCCTCTTACTAGGAACGGTTTTTACCTCGCTTTCCAGGATTATGGAGCCTGTATGTCTCTCCT
T
TCTGTCCGTGTCTTCTTCAAAAAGTGTCCCAGCATCGTGCAGAATTTTGCAGTGTTCCCAGAAACCATG
ACA
GGAGCAGAGAGCACATCTCTGGTGATTGCTCGGGGCACATGCATCCCAAATGCGGAAGAAGTGGATG
TG
CCCATAAAACTCTACTGCAACGGAGATGGAGAGTGGATGGTGCCCATTGGGCGCTGTACCTGTAAGCC
T
GGCTATGAGCCTGAGAACAGCGTGGCCTGCAAGGCCTGTCCTGCGGGGACCTTCAAGGCCAGCCAGGAA
GCT
GAAGGCTGCTCCCACTGCCCCTCCAACAGTCGCTCCCCTTCAGAGGCGTCTCCCATCTGCACCTGCC
GG
ACTGGCTATTACCGAGCTGACTTTGATCCACCAGAGGTGGCGTGTACTAGTGTCCCATCGGGTCCTCG
A
AATGTCATCTCCATCGTGAATGAGACATCTATCATTCTAGAGTGGCACCCTCCAAGAGAGACTGGTGGG
AGA
GATGACGTGACGTACAACATCATCTGCAAGAAGTGCCGAGCAGACCGCCGCAGCTGCTCCCGCTGCG
AT
GACAATGTGGAGTTTGTCCCCAGGCAACTGGGCTTGACTGAGTGTCGTGTCTCCATCAGTAGCCTATG
G
GCCCACACCCCGTACACCTTTGATATCCAGGCCATCAATGGAGTCTCTAGCAAGAGTCCCTTTCCCCCA
CAG
CACGTCTCTGTCAACATCACCACAAACCAAGCTGCCCCCTCCACTGTTCCTATCATGCACCAGGTCA
GT
GCCACCATGAGGAGCATCACCTTGTCATGGCCTCAGCCGGAGCAACCCAATGGCATAATCCTGGACTA
T
GAGATCCGGTACTATGAGAAGGAACACAATGAGTTCAACTCTTCCATGGCCAGGAGCCAGACCAACACA
GCA
CGTATCGATGGGCTACGGCCTGGCATGGTATACGTGGTCCAGGTGCGAGCTCGAACCGTGGCTGGCT
AT
GGCAAGTTCAGTGGCAAGATGTGTTTCCAGACTCTGACAGATGATGATTACAAGTCGGAGCTGAGAGA
G
CAGCTACCCCTGATTGCTGGCTCGGCAGCAGCTGGAGTCGTATTTGTTGTGTCTCTGGTGGCCATCTCT
ATT
GTCTGCAGCAGGAAACGAGCTTACAGCAAAGAGGCTGCGTACAGTGATAAGCTTCAACATTACAGCA
CA
GGCCGAGGCTCCCCAGGGATGAAGATCTACATTGACCCATTCACTTATGAGGACCCCAATGAAGCCGT
C
CGGGAATTTGCCAAGGAGATTGATGTATCTTTTGTGAAAATTGAAGAGGTCATCGGAGCAGGGGAGTTC
GGC
GAGGTGTACAAGGGCCGTTTGAAGCTGCCAGGCAAGAGGGAAATCTATGTGGCCATCAAGACCCTGA
AG
GCTGGGTACTCAGAGAAACAGCGTCGGGATTTTCTGAGCGAGGCGAGCATCATGGGCCAGTTTGACCA
T
CCCAACATCATTCGCCTGGAGGGTGTCGTCACCAAGAGCCGGCCTGTCATGATCATTACGGAGTTCATG
GAG
AACGGCGCTTTAGACTCTTTCCTCCGGCAAAATGATGGACAGTTCACCGTGATCCAGCTTGTGGGGA
TG
CTGAGGGGCATCGCTGCTGGCATGAAGTACCTATCTGAGATGAATTATGTGCACCGGGACCTGGCTGC
T
AGAAACATTCTGGTCAACAGCAACCTGGTGTGCAAAGTTTCTGACTTTGGTCTCTCTCGCTACCTCCAG
GAT
GACACCTCAGACCCCACCTACACCAGCTCCTTGGGAGGGAAGATCCCTGTGAGATGGACAGCTCCAG
AG
GCCATCGCCTACCGCAAGTTTACGTCAGCCAGCGATGTCTGGAGCTATGGGATTGTCATGTGGGAAGT
G
ATGTCATTTGGAGAGAGACCTTACTGGGATATGTCCAATCAAGATGTCATCAATGCCATTGAGCAGGAT
TAC
CGGCTGCCTCCTCCTATGGACTGCCCAGCTGCCCTGCACCAGCTCATGCTGGACTGTTGGCAGAAGG
AT
CGCAATAGCCGGCCCCGTTTTGCAGAGATCGTCAACACCCTGGACAAGATGATCCGGAACCCAGCTAG
T
CTCAAGACTGTGGCAACCATCACCGCTGTGCCTTCCCAACCCCTGCTTGACCGCTCTATCCCAGACTTC
ACG
GCCTTTACCACCGTGGATGACTGGCTAAGTGCCATCAAAATGGTCCAGTACAGGGACAGCTTCCTCA
CC
GCAGGCTTCACCTCCCTTCAGCTGGTCACCCAGATGACATCAGAAGACCTCCTGAGAATAGGGGTAAC
C
TTGGCAGGCCATCAGAAGAAGATTCTGAGTAGCATTCACTCAATGAGGGTCCAGATGAACCAGTCACCA
TCG
GTAATGGCGTGA


Translation (984 aa):
MALDCLLLFLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNN
W
LLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTI
A
ADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETM
T
GAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACK
ACPAGTFKASQE
A
EGCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACT
SVPSGPRNVISIVNETSIILEWHPPRETGG
R
DDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
Q
HVSVNITTNQA
APSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNT
A
RIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTD
DDYKSELREQLPLIAGSAAAGVVFVVSLVAIS
I
VCS
RKRAYSKEAAYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEF
G
EVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFM
E
NGALDSFLR
QNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQ
D
DTSDPTYTSSL
GGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
Y
RLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA
VPSQPLLDRSIPDF
T
AFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTS
EDLLRIGVTLAGHQKKILSSIHSMRVQMNQSP
S
VMA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser