NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40636.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40636.1 Public Mus musculus 9 Atm 21 106 86 CCDS HistoryNCBI Gene:11920Re-query CCDS DB by CCDS ID:40636.1Re-query CCDS DB by GeneID:11920See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40636.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000118282 ENSMUSP00000113388 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118282Link to Ensembl Protein Viewer:ENSMUSP00000113388Re-query CCDS DB by Nucleotide ID:ENSMUST00000118282Re-query CCDS DB by Protein ID:ENSMUSP00000113388
Original member Current member EBI,WTSI OTTMUST00000078538 OTTMUSP00000041767 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000078538Link to Vega Protein Viewer:OTTMUSP00000041767Re-query CCDS DB by Nucleotide ID:OTTMUST00000078538Re-query CCDS DB by Protein ID:OTTMUSP00000041767
Original member Current member NCBI NM_007499.2 NP_031525.2 Accepted alive Link to Nucleotide Sequence:NM_007499.2Link to Protein Sequence:NP_031525.2Re-query CCDS DB by Nucleotide ID:NM_007499Re-query CCDS DB by Protein ID:NP_031525Link to BLink:NP_031525.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031525.2 3066 Q62388 3066 100% 0 0

Chromosomal Locations for CCDS 40636.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 53439746 53439929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53440031 53440167 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53441674 53441737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53442407 53442521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53443992 53444078 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53445345 53445510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53448053 53448202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53450518 53450634 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53451549 53451689 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53453353 53453435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53453532 53453670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53454289 53454447 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53454716 53454829 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53455768 53455975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53456494 53456708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53457378 53457491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53458803 53458976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53459713 53459947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53460891 53461010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53461112 53461120 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53462481 53462585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53464153 53464301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53465032 53465134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53465226 53465314 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53467965 53468052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53471352 53471507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53473616 53473703 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53479581 53479758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53480574 53480750 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53482302 53482443 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53484073 53484244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53486009 53486104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53486814 53486946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53487906 53488070 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53488550 53488721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53490111 53490310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53490914 53491040 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53492241 53492368 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53493038 53493284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53494612 53494781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53495852 53496025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53497133 53497253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53498857 53498987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53499122 53499197 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53500672 53500827 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53500920 53501002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53502945 53503144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53503946 53504126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53506543 53506632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53507778 53507903 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53510163 53510288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53511704 53511929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53513105 53513200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53515158 53515352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53516205 53516576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53518503 53518669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53519992 53520155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53522048 53522286 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53524347 53524512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53527173 53527337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53531631 53531776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53533660 53533772 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 53533865 53533936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (9201 nt):
ATGAGTCTAGCACTCAATGATCTGCTCATTTGCTGCCGGCAGTTAGAGCATGACAGAGCTACAGAAAGAA
GG
AAAGAAGTGGATAAATTTAAGCGCCTGATTCAGGATCCTGAAACAGTTCAACATTTAGATAGGCATTC
T
GATTCCAAACAAGGAAAATATCTGAATTGGGATGCTGTTTTCAGGTTTTTACAGAAGTACATTCAAAAA
GAA
ATGGAAAGTCTGAGAACAGCAAAATCAAATGTATCAGCCACCACACAGAGCTCCAGACAGAAGAAGA
TG
CAAGAGATCAGCAGTTTGGTCAGATACTTCATCAAATGTGCAAACAAAAGAGCACCCAGGCTAAAATG
T
CAAGACCTCTTGAATTATGTCATGGATACAGTGAAAGACTCATCTAATGGTCTAACGTATGGAGCTGAC
TGT
AGCAACATACTACTCAAAGACATTCTTTCTGTGAGAAAATACTGGTGTGAAGTATCTCAGCAACAGT
GG
CTAGAATTGTTTTCACTGTACTTCAGGCTGTATCTCAAGCCATCACAGGACATTAATAGAGTTTTAGT
G
GCTAGAATAATTCATGCTGTCACCAGAGGATGCTGTTCACAGACTGATGGATTACCTTCAAAGTTTTTA
GAT
CTTTTTTCCAAGGCTATTCAGTATGCCAGACAAGAAAAGAGCTCTCCTGGCTTAAGTCACATCTTAG
CA
GCCCTTAACATTTTCCTCAAGTCTCTGGCTGTCAACTTCCGAAAACGGGTGTGTGAAGCAGGAGATGA
A
ATTCTTCCTACCTTACTATATATTTGGACTCAACATAGACTTAATGATTCTTTAAAAGAAGTAATTATT
GAA
CTAATTCAACTGCAGATTTATATCCATCATCCACAAGGAGCCAGAGCTCCTGAAGAAGGTGCTTATG
AA
TCCATGAAATGGAAAAGTATCTTGTACAACTTATATGACTTGCTAGTGAATGAGATAAGTCATATAGG
A
AGCCGAGGGAAATATTCCTCAGGATCTCGTAATATTGCTGTCAAGGAAAATCTGATTGACCTGATGGCA
GAT
ATCTGTTACCAGCTTTTTGATGCAGATACCAGATCCGTGGAGATTTCTCAATCTTATGTGACACAAA
GG
GAATCCACTGATTACAGTGTACCTTGCAAAAGAAGGAAAATAGACGTAGGCTGGGAAGTGATAAAAGA
T
TATCTTCAGAAGTCACAGAGTGATTTTGATCTCGTGCCTTGGCTACAGATTACAACCCGATTAATATCA
AAA
TATCCTTCCAGTTTACCTAACTGTGAGCTGTCTCCATTAATACTGATACTGTACCAGCTTCTGCCTC
AA
CAGCGACGTGGAGAACGCATCCCATATGTGTTACGATGCCTTAAGGAAGTTGCCTTATGTCAAGGCAA
G
AAATCAAACCTGGAAAGCTCTCAGAAGTCAGATTTATTGAAACTATGGATCAAAATTTGGTCTATTACC
TTT
CGTGGTATAAGTTCTGGACAAACACAAACTGAAAACTTTGGTTTACTTGAGGCCATCATTCAAGGTA
GT
TTAGTTGAACTTGACAGAGAATTCTGGAAGTTATTTACTGGCTCAGCCTGTAAACCTTCTAGTCCTTC
A
GTATGCTGCTTGACTTTGGCACTTAGCATCTGTGTAGTTCCAGATGCAATAAAAATGGGAACAGAACAA
AGT
GTGTGTGAAGCAAATAGAAGTTTTTCTGTAAAGGAGTCAATAATGAGGTGGCTCTTATTCTACCAGT
TA
GAGGATGACTTAGAAGACAGCACAGAGCTGCCTCCAATTCTTCAGAGTAATTTTCCTCATCTTGTAGT
C
GAAAAAATTCTTGTAAGTCTCACTATGAAAAACTCAAAAGCTGCAATGAAGTTTTTTCAAAGTGTGCCA
GAA
TGTGAACAACACTGCGAAGATAAAGAAGAGCCTTCATTTTCAGAAGTAGAAGAACTGTTTCTTCAGA
CT
ACTTTTGACAAGATGGATTTTTTAACTACTGTCAAAGAGTATGCTGTAGAAAAATTTCAGTCTAGTGT
T
GGCTTCTCTGTCCAGCAAAATCTCAAGGAATCATTGGATCACTATCTTCTGGGATTATCAGAACAGCTT
TTA
AGTAATTACTCTTCTGAGATTACAAGTTCTGAAACCCTTGTCCGGTGTTCAAGTCTTTTGGTGGGTG
TT
CTTGGCTGCTATTGTTACATGGGTATAATAACTGAAGACGAAGCCCATAAATCAGAATTATTCCAGAA
A
GCCAAGTCTCTGATGCAATGTGCAGGAGAAAGTATCTCTCTGTTTAAAAATAAAACAAATGAGGAATCA
AGA
ATTGGTTCATTGAGAAATGTGATGCATCTGTGTACAAGTTGCTTGTGTATACATACCAAGCATACGC
CA
AACAAGATTGCCTCTGGCTTTTTCCTACGATTATTAACATCAAAGCTTATGAATGACATTGCAGATAT
T
TGTAAAAGTTTAGCATCCTGTACGAAAAAGCCATTGGATCACGGAGTACATCCAGGGGAAGATGATGAA
GAT
GGTGGTGGTTGTGACAGTCTGATGGAGGCAGAGGGTCCATCGTCCACTGGTCTTTCTACTGCTTACC
CC
GCTAGTTCTGTGAGCGATGCAAATGATTATGGAGAGAACCAGAATGCTGTTGGTGCCATGAGTCCTTT
A
GCTGCCGACTACCTGTCCAAACAAGATCATCTTCTCTTAGACATGCTCAGGTTCTTAGGCCGATCTGTA
ACT
GCATCTCAGAGCCATACTGTGTCGTTTAGAGGAGCTGACATTAGAAGAAAATTGTTACTGTTGCTTG
AT
TCTAGCATACTCGATCTCATGAAGCCCCTCCACCTGCATATGTACTTAGTGCTCCTGAAGGATCTCCC
T
GGAAACGAGCACTCATTGCCAATGGAAGATGTTGTTGAACTTCTGCAACCATTATCCCTTGTGTGTTCT
CTG
CACCGACGTGACCAAGATGTCTGTAAAACGATTCTAAGCAATGTCCTTCATATAGTGACAAACCTAG
GC
CAGGGCAGTGTGGACATGGAGAGCACACGGATTGCTCAAGGACACTTCCTGACAGTGATGGGAGCATT
T
TGGCATTTGACAAAGGAAAAGAAATGTGTATTCTCTGTAAGAATGGCATTAGTAAAGTGTCTTCAAACA
TTG
CTTGAGGCTGATCCATATTCCGAATGGGCAATTCTTAATGTAAAAGGACAAGACTTTCCTGTAAATG
AA
GCTTTTTCACAATTTCTTGCTGACGATCATCATCAAGTTCGGATGTTGGCTGCAGGGTCAGTCAACAG
A
TTATTTCAGGATATGAGACAAGGCGATTTCTCCAGAAGCTTGAAAGCACTCCCTCTGAAGTTTCAGCAG
ACA
TCTTTTAACAATGCATACACGACAGCAGAGGCGGGGATCAGAGGACTGTTATGTGATTCTCAGAACC
CT
GATCTGCTGGATGAGATCTATAACAGAAAATCTGTACTACTGATGATGATAGCTGTGGTCTTGCACTG
T
AGCCCAGTCTGTGAAAAGCAGGCTTTGTTTGCTTTATGCAAGTCTGTGAAGGAAAACAGACTAGAACCT
CAT
CTTGTGAAAAAGGTTTTAGAGAAAGTCTCCGAATCGTTTGGATGTAGAAGTTTAGAAGACTTCATGA
TT
TCTCACCTAGACTACCTGGTTTTGGAATGGCTGAACCTTCAAGATACTGAATATAGCTTATCTTCTTT
T
CCTTTTATGTTATTAAACTACACAAGCATTGAGGATTTCTATCGGTCTTGTTACAAGATTTTGATCCCA
CAT
TTGGTAATCAGAAGCCATTTTGATGAGGTGAAGTCCATTGCTAATCAGATTCAAAAGTGCTGGAAAA
GC
CTGTTGGTAGATTGCTTTCCGAAGATTCTTGTGCACATCCTTCCTTACTTTGCCTACGAGGGCACGAG
A
GACAGCTACGTGTCACAGAAAAGAGAGACTGCTACCAAGGTCTACGATACTCTTAAAGGGGAAGACTTC
CTA
GGAAAACAGATTGACCAAGTATTCATTAGTAATTTGCCAGAGATTGTGGTGGAGTTGCTGATGACAT
TG
CATGAGACAGCTGACTCGGCTGACTCGGACGCCAGTCAAAGCGCCACCGCCTTGTGTGATTTTTCAGG
G
GATTTGGATCCTGCCCCCAACCCGCCATATTTCCCCTCACATGTCATTCAGGCAACGTTTGCTTACATC
AGC
AACTGTCATAAAACCAAGTTTAAAAGCATTCTAGAAATTCTTTCTAAAATCCCCGATTCCTATCAGA
AA
ATACTTCTGGCCATTTGTGAACAAGCAGCTGAGACAAATAATGTCTTTAAAAAGCACAGAATTCTTAA
A
ATATATCACCTGTTTGTTAGTTTATTACTGAAAGATATACAGAGTGGCCTGGGAGGGGCTTGGGCCTTT
GTC
CTTCGCGATGTTATTTATACTCTGATTCACTACATCAACAAAAGGTCTTCTCATTTCACAGATGTGT
CG
TTGCGTAGCTTTTCCCTTTGCTGTGACCTATTAAGTCGAGTTTGTCATACAGCTGTAACTCAATGTAA
G
GATGCTCTAGAAAGCCATCTTCACGTTATCGTTGGCACACTTATTCCCCTTGTGGATTATCAGGAAGTT
CAA
GAACAGGTATTGGACCTGTTGAAGTACTTAGTGATAGATAACAAAGACAATAAAAACCTCTCTGTCA
CA
ATTAAGCTTTTGGATCCCTTTCCTGACCATGTTATTTTTAAGGACTTGCGTCTTACTCAACAGAAAAT
C
AAATATAGTGGAGGACCTTTTTCACTCTTAGAGGAAATAAACCATTTTCTCTCAGTAAGTGCTTACAAT
CCA
CTTCCGCTGACCAGGCTTGAAGGACTGAAGGATCTTCGAAGACAACTGGAGCAACATAAAGATCAGA
TG
CTAGATCTTCTGAGAGCGTCTCAAGATAACCCACAAGATGGCATTGTGGTGAAGCTAGTTGTCAGCTT
G
TTGCAGTTATCCAAGATGGCAGTGAACCAGACTGGTGAAAGAGAAGTTTTAGAGGCTGTCGGAAGGTGT
TTG
GGAGAAATAGGTCCTCTGGATTTCTCCACCATAGCTGTCCAGCATAACAAAGATGTGTCCTATACCA
AA
GCCTACGGGTTACCTGAAGACAGAGAACTTCAGTGGACCTTGATAATGCTGACTGCCCTCAACAATAC
C
CTGGTAGAGGACAGTGTCAAAATTCGATCTGCTGCTGCTACCTGTTTGAAAAACATTTTGGCTACAAAG
ATT
GGACATATTTTCTGGGAGAATTATAAGACATCAGCGGATCCAATGCTGACCTATCTACAACCTTTTA
GA
ACATCGAGGAAAAAGTTTTTAGAAGTGCCCCGATCTGTTAAAGAAGATGTTTTAGAAGGCCTGGATGC
T
GTGAATCTGTGGGTTCCTCAAAGTGAAAGTCATGACATTTGGATAAAGACACTGACGTGTGCCTTTCTG
GAC
AGTGGAGGCATAAACAGTGAAATTCTCCAGTTATTAAAGCCAATGTGTGAAGTGAAAACCGACTTCT
GT
CAGATGTTGCTGCCATACTTGATCCATGATGTTTTACTGCAAGATACACATGAATCGTGGAGAACTCT
G
CTGTCTGCGCACGTCCGAGGATTTTTCACTAGTTGTTTTAAGCATTCCTCCCAAGCAAGCCGCTCAGCA
ACT
CCTGCAAATTCGGATTCAGAGTCAGAGAACTTTCTCCGATGCTGTTTGGATAAAAAGTCACAAAGAA
CC
ATGCTTGCTGTTGTCGACTATCTGAGAAGGCAAAAGAGACCTTCCTCGGGAACAGCTTTTGATGACGC
T
TTCTGGCTGGATTTGAATTATCTTGAGGTTGCGAAGGTGGCTCAGTCCTGCTCTGCTCACTTCACGGCC
TTG
CTCTACGCAGAGATCTATTCAGATAAGAAAAGCACAGACGAGCAAGAGAAAAGAAGTCCAACATTTG
AA
GAAGGAAGTCAAGGAACAACTATTTCTAGTTTGAGTGAAAAAAGTAAAGAAGAAACTGGAATAAGCTT
A
CAGGATCTTCTCTTAGAGATCTACAGAAGTATAGGAGAGCCGGACAGCCTGTATGGCTGTGGAGGAGGG
AAA
ATGTTACAACCCCTTACTAGAATACGGACATATGAACATGAAGCTACGTGGGAGAAAGCCTTAGTAA
CT
TACGACCTGGAGACCAGCATCTCCTCCTCCACCCGCCAGTCAGGAATCATCCAGGCCCTGCAGAATTT
G
GGGCTCTCCCATATCCTGTCTGTCTATCTGAAAGGATTAGACTATGAAAGACGAGAGTGGTGCGCTGAG
CTG
CAGGAGCTGCGTTACCAGGCGGCGTGGAGGAACATGCAGTGGGGCCTCTGCGCTTCTGCCGGCCAAG
AA
GTAGAAGGAACCAGTTACCATGAATCGTTGTATAATGCTCTGCAGTGTCTAAGAAACAGAGAATTCTC
C
ACATTTTATGAAAGTCTCCGATATGCCAGTCTTTTCAGGGTGAAAGAAGTTGAAGAGTTGAGTAAGGGC
AGC
CTTGAGTCTGTATATTCGCTGTATCCCACACTTAGTAGATTGCAGGCAATTGGAGAACTGGAAAACA
GT
GGCGAGCTTTTCTCAAGGTCAGTCACAGACAGAGAGCGCTCTGAAGCATACTGGAAGTGGCAGAAGCA
C
TCCCAGCTTCTGAAAGACAGCGACTTCAGCTTTCAGGAGCCTCTCATGGCTCTGCGCACAGTCATTCTG
GAG
ACCCTGGTACAGAAGGAAATGGAGCGCTCTCAAGGAGCATGCTCTAAGGACATTCTCACCAAACACC
TC
GTTGAATTCTCTGTTCTGGCTCGAACCTTCAAGAACACACAGCTCCCTGAAAGAGCAATATTCAAAAT
T
AAGCAATATAATTCAGCTATTTGTGGAATTTCTGAGTGGCATTTGGAAGAAGCACAAGTATTCTGGGCA
AAA
AAGGAGCAGAGTCTTGCTCTGAGTATTCTCAAGCAGATGATCAAGAAGTTGGACTCCAGCTTTAAAG
AT
AAAGAGAATGATGCAGGTCTCAAAGTCATATACGCAGAGTGTCTGAGGGTTTGTGGCAGCTGGCTGGC
A
GAAACTTGCTTAGAAAACCCTGCAGTCATCATGCAGACCTATCTAGAAAAGGCGGTGAAGGTTGCTGGA
AGT
TACGATGGCAACAGCAGAGAGCTCAGAAATGGACAGATGAAGGCCTTTCTCTCGTTGGCAAGGTTCT
CT
GATACTCAGTACCAGAGAATTGAAAACTACATGAAGTCATCAGAATTTGAAAACAAGCAAACTCTCTT
A
AAAAGAGCCAAAGAGGAAGTGGGCCTTCTAAGGGAACATAAAATTCAGACCAACAGATACACAGTAAAG
GTT
CAGCGAGAACTGGAGCTGGACGAATGTGCTCTCCGTGCACTGAGAGAGGATCGCAAGCGCTTCCTGT
GT
AAAGCAGTGGAGAACTACATCAACTGCTTACTAAGCGGGGAAGAACATGATCTGTGGGTGTTCCGGCT
T
TGCTCCCTCTGGCTTGAAAATTCTGGAGTTTCTGAAGTCAATGGCATGATGAAGAAAGATGGAATGAAG
ATT
TCATCCTATAAGTTTTTGCCTCTCATGTATCAATTGGCTGCTCGAATGGGGACCAAAATGACGGGAG
GC
CTAGGATTTCACGAAGTCCTCAATAATCTAATCTCTAGGATTTCACTGGATCACCCCCATCATACTTT
G
TTCATTATACTGGCCTTAGCAAATGCGAACAAAGATGAATTTTTGAGCAAACCAGAGACAACAAGAAGG
AGT
CGAATAACCAAAAGTACATCTAAAGAAAACTCTCACCTTGATGAGGATCGAACAGAGGCTGCAACCA
GA
ATCATCCACTCCATCAGAAGTAAGCGATGTAAGATGGTGAAGGACATGGAGGCGCTCTGCGATGCCTA
C
ATCATCTTGGCAAACATGGACGCCTCTCAGTGGAGGGCTCAGAGAAAAGGCATCAATATTCCAGCCAAC
CAG
CCAATCACTAAACTGAAGAATTTAGAAGATGTTGTTGTTCCCACTATGGAAATTAAGGTTGATCCCA
CA
GGAGAGTATGAAAATCTGGTGACTATAAAATCATTTAAAACAGAATTTCGCTTAGCTGGAGGCTTAAA
T
TTACCCAAAATAATAGATTGTGTGGGTTCTGATGGCAAGGAAAGGAGACAGCTTGTGAAGGGCCGTGAT
GAC
CTGAGGCAAGATGCTGTCATGCAGCAGGTCTTCCAGATGTGCAATACACTACTGCAGAGAAACACTG
AG
ACTAGAAAGAGGAAACTGACTATCTGCACATACAAGGTGGTTCCCCTTTCTCAGCGAAGCGGTGTTCT
C
GAGTGGTGCACAGGAACCGTTCCTATTGGTGAATATCTTGTTAACAGCGAAGACGGTGCACATAGAAGA
TAC
AGGCCAAATGATTTCAGTGCCAATCAGTGCCAAAAGAAAATGATGGAAGTGCAGAAGAAGTCTTTTG
AA
GAGAAATATGATACCTTCATGACGATTTGCCAAAACTTTGAACCAGTTTTCCGTTACTTCTGCATGGA
A
AAATTCTTGGACCCAGCTGTTTGGTTTGAGAAACGATTGGCATATACACGCAGTGTGGCCACATCTTCT
ATC
GTCGGTTACATCCTTGGACTTGGCGACAGGCACGTACAGAATATCTTGATAAACGAGCAGTCGGCAG
AG
CTTGTGCACATAGACCTGGGAGTGGCTTTTGAACAGGGGAAGATCCTTCCCACTCCAGAAACAGTTCC
T
TTTAGACTCAGCAGAGATATTGTGGACGGGATGGGCATCACCGGTGTGGAAGGTGTCTTCAGAAGGTGC
TGT
GAAAAAACGATGGAAGTTATGCGGAGTTCTCAGGAAACCCTGCTGACCATTGTAGAGGTTCTTTTGT
AC
GATCCACTCTTTGATTGGACTATGAATCCTTTAAAAGCTCTGTATCTACAGCAGAGACCAGAAGATGA
G
TCCGACCTCCATTCCACCCCCAATGCAGATGATCAAGAATGCAAACAAAGTCTTAGTGATACTGACCAG
AGT
TTCAACAAAGTAGCTGAGCGTGTCTTGATGAGACTGCAAGAGAAACTGAAAGGCGTGGAGGAAGGCA
CT
GTGCTCAGTGTGGGTGGACAGGTGAACTTGCTTATCCAGCAGGCCATGGATCCCAAAAATCTCAGCCG
A
CTCTTCCCAGGATGGAAAGCTTGGGTGTGA


Translation (3066 aa):
MSLALNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAVFRFLQKYIQK
E
MESLRTAKSNVSATTQSSRQKKMQEISSLVRYFIKCANK
RAPRLKCQDLLNYVMDTVKDSSNGLTYGAD
C
SNILLKDILSVRKYWCEVSQQQWL
ELFSLYFRLYLKPSQDINRVLVARIIHAVTRGCCSQTDGLPSKFL
D
LFSKAIQYA
RQEKSSPGLSHILAALNIFLKSLAVNFRKRVCEAGDEILPTLLYIWTQHRLNDSLKEVII
E
LIQLQIYIHHPQGARAPEE
GAYESMKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMA
D
ICYQ
LFDADTRSVEISQSYVTQRESTDYSVPCKRRKIDVGWEVIKDYLQKSQSDFDLVPWLQITTRLIS
K
YPSSLPNCELSPLILILYQLLPQQRRGERIPYVLRCLKEVALCQGKKSNLESSQKSDLLKLWIKIWSIT
F
RGISSGQTQTENFGLLEAIIQGSLVELDREFWKLFTGSACKPS
SPSVCCLTLALSICVVPDAIKMGTEQ
S
VCEANRSFSVKESIMRWLLFYQLEDDLEDSTELPPILQ
SNFPHLVVEKILVSLTMKNSKAAMKFFQSVP
E
CEQHCEDKEEPSFSEVEELFLQTTFDKMDFLTTVKEYAVEKFQSSVGFSVQQNLKESLDHYLLGLSEQL
L
SNYSSE
ITSSETLVRCSSLLVGVLGCYCYMGIITEDEAHKSELFQKAKSLMQCAGESISLFKNKTNEES
R
IGSLRNVMHLCTSCLCIHTK
HTPNKIASGFFLRLLTSKLMNDIADICKSLASCTKKPLDHGVHPGEDDE
D
GGGCDSLMEAEGPSSTGLSTAYPASSVSDANDYGENQNAV
GAMSPLAADYLSKQDHLLLDMLRFLGRSV
T
ASQSHTVSFRGADIRRKLLLLLDSSILDLMKPLHLHM
YLVLLKDLPGNEHSLPMEDVVELLQPLSLVCS
L
HRRDQDVCKTILSNVLHIVTNLGQGSVDMESTRIAQGHFLTVMGAF
WHLTKEKKCVFSVRMALVKCLQT
L
LE
ADPYSEWAILNVKGQDFPVNEAFSQFLADDHHQVRMLAAGSVNRLFQDMRQGDFSRSLKALPLKFQQ
T
SFNNAYTTAEAGIRGL
LCDSQNPDLLDEIYNRKSVLLMMIAVVLHCSPVCEKQALFALCKSVKENRLEP
H
LVKK
VLEKVSESFGCRSLEDFMISHLDYLVLEWLNLQDTEYSLSSFPFMLLNYTSIEDFYRSCYKILIP
H
LVIRSHFDEVKSIANQIQKCWKSLLVDCFPKILVHILPYFAYEGTRDSYVSQKRETATKVYDTLKGEDF
L
GKQ
IDQVFISNLPEIVVELLMTLHETADSADSDASQSATALCDFSGDLDPAPNPPYFPSHVIQATFAYI
S
NCHKTKFKSILEILSKIP
DSYQKILLAICEQAAETNNVFKKHRILKIYHLFVSLLLKDIQSGLGGAWAF
V
LRDVIYTLIHYINK
RSSHFTDVSLRSFSLCCDLLSRVCHTAVTQCKDALESHLHVIVGTLIPLVDYQEV
Q
EQ
VLDLLKYLVIDNKDNKNLSVTIKLLDPFPDHVIFKDLRLTQQKIKYSGGPFSLLEEINHFLSVSAYN
P
LPLTRLEGLKDLRRQLEQHKDQMLDLLRASQ
DNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGRC
L
GEIGPLDFSTIAVQHNKDVSYTKAYGLPEDRELQWTLIMLTALNNTLVED
SVKIRSAAATCLKNILATK
I
GHIFWENYKTSADPMLTYLQPFRTSRKK
FLEVPRSVKEDVLEGLDAVNLWVPQSESHDIWIKTLTCAFL
D
SGGINSEILQLLKPMCE
VKTDFCQMLLPYLIHDVLLQDTHESWRTLLSAHVRGFFTSCFKHSSQASRSA
T
PANSDS
ESENFLRCCLDKKSQRTMLAVVDYLRRQKRPSSGTAFDDAFWLDLNYLEVAKVAQSCSAHFTA
L
LYAEIYSDKKSTDEQEK
RSPTFEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGG
K
MLQPLT
RIRTYEHEATWEKALVTYDLETSISSSTRQSGIIQALQNLGLSHILSVYLKGLDYERREWCAE
L
QELRYQAAWRNMQWGLCASA
GQEVEGTSYHESLYNALQCLRNREFSTFYESLRYASLFRVKEVEELSKG
S
LESVYSLYPTLSRLQAIGELENSGELFS
RSVTDRERSEAYWKWQKHSQLLKDSDFSFQEPLMALRTVIL
E
TLVQKEMERSQGACSKDILTKHLVEFSVLARTFKNTQ
LPERAIFKIKQYNSAICGISEWHLEEAQVFWA
K
KEQSLALSILKQMIKKLDSSFKDKE
NDAGLKVIYAECLRVCGSWLAETCLENPAVIMQTYLEKAVKVAG
S
YDGNSRELRNGQMKAFLSLARFSDTQYQRIENYMKSSEFENKQTLLKRAKEEVGLLREHKIQTN
RYTVK
V
QRELELDECALRALREDRKRFLCKAVENYINCLLSGEEHDLWVFRLCSLWLENSGVSEVNGMMK
KDGMK
I
SSYKFLPLMYQLAARMGTKMTGGLGFHEVLNN
LISRISLDHPHHTLFIILALANANKDEFLSKPETTRR
S
RITKSTSKENSHLDE
DRTEAATRIIHSIRSKRCKMVKDMEALCDAYIILANMDASQWRAQRKGINIPAN
Q
PITKLKNLEDVVVPTMEIK
VDPTGEYENLVTIKSFKTEFRLAGGLNLPKIIDCVGSDGKERRQLVKGRD
D
LRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYK
VVPLSQRSGVLEWCTGTVPIGEYLVNSEDGAHRR
Y
RPNDFSANQCQKKMM
EVQKKSFEEKYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSS
I
VGYILGLGDRHVQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRC
C
EKTMEVMRSSQETLLTIVE
VLLYDPLFDWTMNPLKALYLQQRPEDESDLHSTPNADDQECKQSLSDTDQ
S
FNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser