NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40618.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40618.1 Public Mus musculus 9 Ncam1 21 106 86 CCDS HistoryNCBI Gene:17967Re-query CCDS DB by CCDS ID:40618.1Re-query CCDS DB by GeneID:17967See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40618.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000114476 ENSMUSP00000110120 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114476Link to Ensembl Protein Viewer:ENSMUSP00000110120Re-query CCDS DB by Nucleotide ID:ENSMUST00000114476Re-query CCDS DB by Protein ID:ENSMUSP00000110120
Original member Current member EBI,WTSI OTTMUST00000131054 OTTMUSP00000070137 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000131054Link to Vega Protein Viewer:OTTMUSP00000070137Re-query CCDS DB by Nucleotide ID:OTTMUST00000131054Re-query CCDS DB by Protein ID:OTTMUSP00000070137
Original member Current member NCBI NM_010875.3 NP_035005.2 Accepted alive Link to Nucleotide Sequence:NM_010875.3Link to Protein Sequence:NP_035005.2Re-query CCDS DB by Nucleotide ID:NM_010875Re-query CCDS DB by Protein ID:NP_035005Link to BLink:NP_035005.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035005.2 725 P13595-3 725 99.8621% 0 1

Chromosomal Locations for CCDS 40618.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 49517506 49517582 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49520035 49520212 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49523522 49523646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49543011 49543142 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49544651 49544821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49545153 49545249 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49545599 49545783 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49546158 49546308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49557096 49557238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49564869 49565041 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49565469 49565586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49566675 49566812 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49567337 49567480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49568331 49568549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49569826 49569900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 49798678 49798729 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2178 nt):
ATGCTGCGAACTAAGGATCTCATCTGGACTTTGTTTTTCCTGGGAACTGCAGTTTCCCTGCAGGTAGATA
TT
GTTCCCAGCCAAGGAGAAATCAGCGTTGGAGAGTCCAAATTCTTCCTGTGTCAAGTGGCAGGAGATGC
C
AAAGATAAGGACATCTCCTGGTTCTCCCCCAATGGGGAGAAGCTGAGCCCAAACCAGCAGCGGATCTCA
GTG
GTGTGGAATGATGACGACTCCTCTACCCTCACCATCTACAACGCCAACATCGACGATGCCGGCATAT
AC
AAGTGTGTGGTCACGGCTGAGGACGGCACCCAGTCTGAGGCCACTGTCAACGTGAAGATCTTCCAGAA
G
CTCATGTTCAAGAATGCACCAACCCCACAGGAGTTTAAGGAAGGGGAGGATGCTGTGATTGTCTGTGAT
GTG
GTCAGCTCCCTGCCTCCAACCATCATCTGGAAACACAAAGGCCGAGATGTCATTCTGAAAAAAGACG
TC
CGGTTCATAGTCCTGTCCAACAACTACCTGCAGATCAGGGGCATCAAGAAAACAGATGAGGGTACTTA
C
CGCTGTGAGGGCAGGATCCTGGCCCGCGGGGAAATCAACTTCAAGGACATTCAGGTCATTGTGAATGTA
CCA
CCCACTGTCCAGGCCAGACAGAGCATCGTGAATGCCACTGCCAACCTGGGCCAGTCTGTCACCCTGG
TG
TGTGATGCCGATGGCTTCCCAGAGCCCACCATGAGCTGGACAAAGGATGGGGAACCCATAGAGAACGA
G
GAGGAAGATGACGAGAAGCACATCTTCAGTGATGACAGCTCCGAGCTGACCATCAGGAATGTGGATAAA
AAC
GACGAGGCCGAATACGTCTGCATCGCAGAGAACAAGGCTGGCGAGCAGGATGCCTCCATCCACCTCA
AG
GTCTTTGCAAAGCCCAAAATCACCTATGTAGAGAATCAGACGGCCATGGAACTAGAGGAGCAAGTCAC
T
CTGACCTGTGAAGCCTCCGGAGACCCCATCCCCTCCATCACCTGGAGAACATCCACCCGGAACATCAGC
AGT
GAAGAAAAGACTCTGGATGGGCACATGGTGGTTCGCAGCCATGCTCGTGTGTCCTCCTTGACCCTGA
AG
AGCATCCAGTACACAGATGCTGGAGAATACATCTGCACTGCCAGCAACACCATCGGCCAGGATTCCCA
G
TCCATGTACCTCGAAGTTCAATATGCTCCCAAGCTCCAGGGCCCTGTGGCTGTGTACACTTGGGAAGGG
AAC
CAGGTGAACATCACCTGTGAGGTCTTCGCCTACCCAAGTGCCACAATCTCCTGGTTCCGAGATGGTC
AG
TTGCTGCCAAGCTCCAACTACAGCAATATCAAGATCTACAACACCCCATCTGCTAGCTATCTGGAGGT
G
ACCCCTGATTCAGAAAATGACTTTGGAAACTACAACTGTACAGCAGTGAACCGTATTGGACAGGAGTCC
TTG
GAATTCATCCTTGTTCAAGCAGACACACCGTCTTCTCCATCCATTGACCGGGTGGAACCATACTCCA
GC
ACAGCGCAGGTGCAGTTTGATGAGCCAGAGGCCACAGGGGGCGTGCCCATTCTCAAGTACAAGGCTGA
G
TGGAAGTCGCTGGGCGAAGAATCCTGGCATTTCAAGTGGTATGATGCCAAAGAAGCCAACATGGAAGGC
ATT
GTCACCATCATGGGCCTGAAACCTGAGACGAGGTACTCGGTACGACTGGCGGCCCTCAACGGCAAGG
GG
CTGGGCGAGATCAGTGCAGCCACTGAGTTCAAGACACAGCCAGTCCGGGAACCCAGTGCACCCAAGCT
G
GAAGGGCAGATGGGAGAGGACGGGAACTCCATCAAGGTGAACCTGATCAAGCAGGATGACGGAGGCTCC
CCC
ATCAGACACTATCTGGTCAAGTACAGAGCGCTCGCCTCTGAGTGGAAACCGGAAATCAGGCTCCCAT
CC
GGCAGTGACCACGTCATGCTCAAGTCCCTGGACTGGAACGCAGAGTATGAAGTCTATGTGGTAGCTGA
A
AACCAGCAAGGAAAATCCAAGGCAGCTCACTTTGTGTTCAGGACCTCAGCCCAGCCCACGGCCATCCCA
G
CC
ACCCTGGGCGGAAGCTCCACCTCCTACACCTTGGTCTCATTGCTTTTCTCTGCGGTGACTCTTCTTC
TG
CTCTGA


Translation (725 aa):
MLRTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRIS
V
VWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIF
QKLMFKNAPTPQEFKEGEDAVIVCD
V
VSSLPPTIIWKHKGRDVILKKD
VRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNV
P
PTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWT
KDGEPIENEEEDDEKHIFSDDSSELTIRNVDK
N
DEAEYVCIAENKAGEQDASIHLKVF
AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNIS
S
EEK
TLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEG
N
QVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLE
VTPDSENDFGNYNCTAVNRIGQES
L
EFILVQA
DTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEG
I
VTIMGLKPETRYSVRLAALNGKGLGEISAATEFKTQPV
REPSAPKLEGQMGEDGNSIKVNLIKQDDGGS
P
IRHYLVKYRA
LASEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
A
TLGGSSTSYTLVSLLFSAVTLLLL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser