NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40516.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40516.1 Public Mus musculus 8 Fam89a 21 106 86 CCDS HistoryNCBI Gene:69627Re-query CCDS DB by CCDS ID:40516.1Re-query CCDS DB by GeneID:69627See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 40516.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055257 ENSMUSP00000058156 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055257Link to Ensembl Protein Viewer:ENSMUSP00000058156Re-query CCDS DB by Nucleotide ID:ENSMUST00000055257Re-query CCDS DB by Protein ID:ENSMUSP00000058156
Original member Current member EBI,WTSI OTTMUST00000150184 OTTMUSP00000077860 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000150184Link to Vega Protein Viewer:OTTMUSP00000077860Re-query CCDS DB by Nucleotide ID:OTTMUST00000150184Re-query CCDS DB by Protein ID:OTTMUSP00000077860
Original member Current member NCBI NM_001081120.1 NP_001074589.1 Accepted alive Link to Nucleotide Sequence:NM_001081120.1Link to Protein Sequence:NP_001074589.1Re-query CCDS DB by Nucleotide ID:NM_001081120Re-query CCDS DB by Protein ID:NP_001074589Link to BLAST:NP_001074589.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074589.1 175 Q14BJ1-1 175 100% 0 0

Chromosomal Locations for CCDS 40516.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 124741044 124741301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 124751540 124751809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (528 nt):
ATGAGCGGAACCGGGTCCGCCGGCATGGCCCGGGGGCTGCGCGTGGACGGGCTGCCACCGCTACCCAAAA
GC
CTGAGCGGGCTGCTGCACTCGGCGGCGGGAGGCGCGGCGGGTGGCTGGCGGCACCTGGAGCGGCTGTA
C
GCTCAGAAGTCGCGCATCCAGGACGAGCTGAACCGAGGGGGCGCGGGCGGCGGCGGGGCGCGGGCGGCC
GGG
ATGCGGACCAAGCCCCCCAACCTGGACGCCGCGCTGGCGCTGTTGCGCAAGGAGATGGTCGGCCTCC
GA
CAGCTGGACATGTCCTTGCTCTGCCAACTGTACAGCCTCTACGAGTCCATTCAGGAGTACAAGGGAGC
G
TGCCAGGCAGCCTCCAGTCTGGACTGCACCTATGCGCTGGAGAATGGCTTCTTCGACGATGAGGAGGAC
TTC
CAGGAGCAGGGCTCTCTGCAGGACGGGCAGCACCATGGCTCTCCCAGGGACCAGTCGCCCCTTACCC
AC
CTCTCCAGCAGTGACTGGATTCTGGAGTCCATCTAG


Translation (175 aa):
MSGTGSAGMARGLRVDGLPPLPKSLSGLLHSAAGGAAGGWRHLERLYAQKSRIQDELNRGGAGGGGARAA
G
MRTKPPNLDAALALLRKEM
VGLRQLDMSLLCQLYSLYESIQEYKGACQAASSLDCTYALENGFFDDEED
F
QEQGSLQDGQHHGSPRDQSPLTHLSSSDWILESI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser