NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40470.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40470.1 Public Mus musculus 8 Hp 21 106 86 CCDS HistoryNCBI Gene:15439Re-query CCDS DB by CCDS ID:40470.1Re-query CCDS DB by GeneID:15439See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40470.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000074898 ENSMUSP00000074436 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000074898Link to Ensembl Protein Viewer:ENSMUSP00000074436Re-query CCDS DB by Nucleotide ID:ENSMUST00000074898Re-query CCDS DB by Protein ID:ENSMUSP00000074436
Original member Current member EBI,WTSI OTTMUST00000151104 OTTMUSP00000078361 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000151104Link to Vega Protein Viewer:OTTMUSP00000078361Re-query CCDS DB by Nucleotide ID:OTTMUST00000151104Re-query CCDS DB by Protein ID:OTTMUSP00000078361
Original member Current member NCBI NM_017370.2 NP_059066.1 Accepted alive Link to Nucleotide Sequence:NM_017370.2Link to Protein Sequence:NP_059066.1Re-query CCDS DB by Nucleotide ID:NM_017370Re-query CCDS DB by Protein ID:NP_059066Link to BLink:NP_059066.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_059066.1 347 Q61646 347 100% 0 0

Chromosomal Locations for CCDS 40470.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 109575271 109576049 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 109576705 109576779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 109577130 109577231 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 109577480 109577562 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 109579010 109579014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1044 nt):
ATGAGAGCCCTGGGAGCTGTTGTCACTCTCCTGCTCTGGGGTCAGCTTTTTGCTGTGGAGTTGGGCAATG
AT
GCCATGGACTTTGAAGATGACAGCTGCCCAAAGCCCCCAGAGATTGCAAACGGCTATGTGGAGCACTT
G
GTTCGCTATCGCTGCCGACAGTTCTACAGACTACGGGCCGAAGGAGATGGGGTGTACACCTTAAACGAC
GAG
AAGCAATGGGTGAACACAGTCGCTGGAGAGAAACTCCCCGAATGTGAGGCAGTGTGTGGGAAGCCCA
AG
CACCCTGTGGACCAGGTGCAGCGCATCATCGGTGGCTCTATGGATGCCAAAGGCAGCTTTCCTTGGCA
G
GCCAAGATGATCTCCCGCCACGGACTCACCACCGGGGCCACGTTGATCAGTGACCAGTGGCTGCTGACC
ACG
GCCAAAAACCTCTTCCTGAACCACAGCGAGACGGCGTCAGCCAAGGACATCACCCCCACCCTAACGC
TC
TACGTGGGGAAAAACCAGCTGGTGGAGATTGAGAAGGTCGTTCTCCACCCCAACCACTCCGTGGTGGA
T
ATCGGGCTAATCAAACTCAAGCAGAGGGTGCTTGTAACCGAGAGAGTCATGCCTATCTGCCTGCCTTCC
AAA
GACTACATAGCACCAGGCCGTGTGGGCTACGTGTCTGGCTGGGGGCGGAACGCCAACTTTAGATTTA
CC
GATCGTCTCAAGTATGTCATGCTGCCTGTGGCCGACCAGGACAAGTGTGTGGTGCACTATGAGAATAG
T
ACAGTGCCCGAGAAGAAAAACTTGACGAGTCCCGTTGGGGTCCAGCCTATCTTGAACGAGCACACCTTC
TGT
GCTGGCCTCACCAAGTACCAGGAAGACACCTGCTACGGTGACGCCGGCAGTGCCTTTGCCATTCATG
AC
ATGGAGGAGGACACCTGGTACGCAGCTGGGATCCTGAGCTTTGACAAGAGCTGCGCTGTCGCTGAGTA
T
GGTGTGTACGTGAGGGCGACCGACCTGAAGGACTGGGTTCAGGAAACCATGGCCAAGAACTAG


Translation (347 aa):
MRALGAVVTLLLWGQLFAVELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLND
E
KQWVNTVAGEKLPECEA
VCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLT
T
AKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPS
K
DYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTF
C
AGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser