NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40464.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40464.1 Public Mus musculus 8 Nfat5 21 106 86 CCDS HistoryNCBI Gene:54446Re-query CCDS DB by CCDS ID:40464.1Re-query CCDS DB by GeneID:54446See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 40464.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000077440 ENSMUSP00000076653 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000077440Link to Ensembl Protein Viewer:ENSMUSP00000076653Re-query CCDS DB by Nucleotide ID:ENSMUST00000077440Re-query CCDS DB by Protein ID:ENSMUSP00000076653
Original member Current member NCBI NM_133957.3 NP_598718.2 Accepted alive Link to Nucleotide Sequence:NM_133957.3Link to Protein Sequence:NP_598718.2Re-query CCDS DB by Nucleotide ID:NM_133957Re-query CCDS DB by Protein ID:NP_598718Link to BLAST:NP_598718.2

Chromosomal Locations for CCDS 40464.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 107338838 107339367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107344786 107344978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107347667 107347857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107351427 107351599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107355515 107355649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107355770 107355822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107358634 107358766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107361744 107361824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107366179 107366327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107367049 107369551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 107370418 107370653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4377 nt):
ATGGGCGGTGCTTGCAGCTCCTTTACCACCTCTTCCAGCCCTACCATTTATTCTACCTCAGTCACCGACA
GC
AAGGCTATGCAAGTGGAGAGCTGCTCCTCAGCCGTGGGGGTAAGTAACAGAGGGGTAAGTGAAAAGCA
G
TTAACCGGTAACACAGTTCAGCAGCATCCATCAACCCCGAAGAGGCACACAGTTTTGTACATCTCACCA
CCA
CCTGAGGACTTGCTGGATAACAGTCGGATGTCCTGCCAGGATGAGGGGTGTGGATTGGAATCTGAGC
AG
AGCTGCAGTATGTGGATGGAGGATTCCCCCTCCAACTTCAGTAACATGAGCACCAGTTCCTACAATGA
T
AACACTGAGGTACCTCGTAAATCACGAAAACGAAATCCAAAGCAGAGGCCGGGGGTCAAACGACGAGAT
TGT
GAAGAATCTAATATGGATATATTTGATGCCGACAGTGCCAAAGCACCTCACTATGTGCTTTCTCAGC
TT
ACCACGGACAACAAAGGCAACTCAAAAGCTGGAAATGGAACATTGGACAGCCAAAAGGGAACTGGAGT
A
AAGAAGAGCCCTATGTTGTGCGGACAGTATCCGGTTAAAAGTGAGGGGAAGGAGCTGAAGATAGTGGTA
CAG
CCTGAAACCCAACACCGAGCCCGGTACCTGACAGAGGGCAGCCGAGGCTCTGTAAAAGACAGAACAC
AG
CAAGGCTTTCCTACGGTGAAGCTGGAAGGCCATAATGAACCAGTGGTGTTGCAGGTATTTGTGGGCAA
T
GATTCTGGTCGAGTAAAACCACATGGATTCTATCAGGCCTGTAGAGTAACTGGGCGAAATACAACTCCC
TGC
AAAGAAGTGGACATTGAAGGTACCACTGTTATAGAAGTTGGTCTTGATCCTAGCAACAACATGACAC
TG
GCGGTGGACTGTGTTGGAATATTGAAGCTGAGGAATGCCGATGTTGAAGCCAGAATTGGAATTGCTGG
A
TCTAAGAAAAAGAGCACTCGTGCCAGATTGGTTTTTCGAGTTAATATCACAAGGAAAGATGGCTCTACT
CTG
ACATTGCAGACACCTTCTTCCCCCATTTTATGCACTCAGCCAGCAGGAGTTCCTGAGATCTTAAAGA
AA
AGCTTGCATAGCTGTTCAGTGAAAGGAGAGGAAGAAGTATTTTTAATTGGGAAAAACTTTCTGAAAGG
A
ACTAAAGTTATTTTCCAGGAAAATGTTTCTGATGAAAACTCTTGGAAATCAGAAGCTGAAATTGACATG
GAG
TTATTCCATCAGAACCATCTTATTGTGAAGGTTCCTCCGTATCATGACCAACATATAACTTTGCCTG
TA
TCAGTGGGAATATATGTTGTGACCAATGCTGGAAGATCTCATGATGTTCAGCCATTTACGTACACTCC
G
GATCCAGCAGCTGGTGCTTTGAATGTAAATGTGAAAAAGGAGATATCTAGTCCAGCAAGACCTTGCTCT
TTT
GAAGAAGCCATGAAAGCAATGAAAACGACTGGATGTAACGTAGATAAGGTGACTATCCTTCCTAATG
CC
CTGATCACTCCACTCATATCAAGCAGTATGATTAAGACTGAAGATGTTACTCCAATGGAAGTAACTTC
A
GAAAAAAGATCTTCCCCAATTTTTCAGACTACAAAGAGCATTGGATCAACCCAGCAAACCTTAGAAACT
ATT
TCTAACATAGCGGGGGGTGCACCCTTCTCCTCACCGTCGTCATCTTCCCACTTAACTCCTGAAAGTG
AG
AATCAGCAGCAGCTTCAGCCCAAGGCATACAACCCAGAGACCCTGACAACTATCCAGACACAGGACAT
C
TCACAGCCCGGGACCTTTCCCGCAGTTTCTGCTGCTAGTCAGCTGCCCAGCAGCGATGCACTACTGCAG
CAG
GCAACACAGTTTCAGACAAGAGAAGCTCAGTCCAGAGACACAATACAGTCAGATACAGTGGTTAACT
TG
TCACAGTTAACTGAAGCATCACAGCAGCAGCAATCCCCACTACAAGAACAAGCACAAACGTTACAGCA
G
CAGATACCATCAAATATTTTTCCATCGCCAAGCAGTGTCAGCCAGCTCCAGAGTACTATTCAGCAGCTG
CAA
GCAGGAAGTTTCACAGGCAGCGCTGCTGGCGGCAGGAGTGGAAGCGTTGATTTGGTCCAGCAGGTTT
TA
GAGGCACAACAGCAGTTATCGTCTGTTCTGTTTTCTACTCCAGATGGGAATGAGAATGTTCAAGAACA
G
CTTAATGCAGACATTTTCCAAGTCAGTCAAATTCAAAATAGTGTAAGCCCTGGAATGTTTTCTTCAGCG
GAG
TCTGCAGTTCACACTAGACCAGATAACTTACTACCTGGGAGGGCTGACAGCGTCCATCAACAGACTG
AA
AATACACTGTCTAATCAGCAGCAGCAGCAACAGCAGCAGCAGCAAGTGATGGAGTCATCAGCTGCAAT
G
GTGATGGAGATGCAGCAGAGCATTTGCCAAGCAGCTGCCCAGATCCAGTCAGAGCTGTTTCCTTCAGCT
GCT
TCAGCAAGTGGAAGCCTTCAGCAGTCTCCAGTTTACCAGCAGCCTTCTCACATGATGAGTGCACTGC
CT
ACCAACGAGGACATGCAGATGCAGTGTGAGCTGTTCTCGTCTCCCCCTGCAGCTTCTGGAAACGAAAC
T
TCCACAACCACCACGCCACAGGTGGCAACCCCTGGCTCCACCATGTTTCAGACACCAAGTTCAGGAGAT
GGA
GAAGAAACTGGAGCACAAGCAAAACAGATTCAGAACAGCGTCTTTCAGACAATGGTCCAAATGCAGC
GC
AGTGGTGACAGCCAACCTCAAGTAAACCTCTTTTCATCTACAAAAAATATAATGAGTGTTCAGAATAA
T
GGTACCCAGCAACAAGGGAATAGCTTGTTCCAGCAAGGGAGCGAGATGATGTCACTTCAGTCTGGGAAC
TTT
TTGCAGCAGTCCTCTCATTCACAGGCTCAGCTCTTTCATCCTCAAAATCCTATTGCTGATGCTCAGA
AC
CTTTCCCAGGAAACTCAAGGTTCAATTTTTCATAGTCCAAATCCTATTGTCCACAGTCAAACTTCCAC
A
GCATCCTCTGAACAACTGCAGCCTTCAATGTTTCACTCTCAGAATACCATTGCTGTGTTACAGGGCTCT
TCA
GTTCCTCAAGACCAGCAGTCACCCAACATATTTCTTTCCCAAAGTTCTATCAATAATCTTCAAACTA
AC
ACAGTAGCCCAAGAAGAGCAGATTTCATTTTTTGCAGCACAGAACTCAATTTCTCCACTTCAGTCAAC
A
TCAAACACTGAGCAGCAAGCTGCTTTCCAACAGCAGCCTCCAATCTCACACATCCAGACCCCTATTCTT
TCC
CAGGAACAGGCACAACCCTCTCAGCAAGGGTTATTTCAGCCTCAGGTGGCCCTTGGCTCCCTGCCTC
CT
AATCCAATGCCTCAAAACCAGCAAGGTCCAATTTTCCAAACACAGCGCCCAATAGTTGGCATGCAGAG
T
AACTCTCCATCCCAGGAGCAGCAGCAGCAGCAACAGCAGCAACAGCAGCAGCAGCAACAGCAACAACAA
CAG
CAACAGAGCATTTTATTCAGTAATCAGAATGCCATGGCTACAATGGCCTCCCAGAAGCAGCCACCAC
CA
AACATGATGTTTAGCCCAAACCAGAACCCAATGGCTAGTCAGGAGCAGCAGAACCAGTCAATTTTTCA
C
CAGCAAAGTAATATGGCCCCAATGAACCAAGAGCAGCAGCCCATGCAATTTCAGAATCAGCCTACGGTT
TCC
TCACTTCAGAACCCAGGTCCTACGCAGTCTGAGTCACCACAGACCTCCTTGTTCCATAGCTCTCCTC
AG
ATCCAGTTGGTTCAAGGGTCACCTAGTTCTCAAGATCAGCAAGTAACACTCTTCCTCTCTCCAGCATC
C
ATGTCTGCATTGCAAACCAGTATAAACCAACCAGACATGCAGCAGTCTCCTCTTTATTCCCCGCAGAAC
AAC
ATCCCTGGAATCCAAGGAAGCACTTCTTCACCCCAGCCACAGGCTACTTTATTTCACAACACTACAG
GA
GGCACAATAAACCAAATACAAAATTCTCCTGGCTCATCTCAGCAGACTTCAGGAATGTTCTTATTTGG
C
ATTCAAAATAATTGTAGTCAGCTTTTAACCTCCGGACCAGCTACATTGCCAGATCAGCTGATGGCCATA
AAT
CAGCAGGGCCAACCACAAAATGAGGGCCAATCTTCTGTGACAACACTTCTTTCTCAGCAAATGCCAG
AG
ACTTCCCCACTGGCCTCCTCTGTGAACAGCAGTCAGAACATGGAAAAGATTGATTTGCTTGTTTCATT
G
CAAAGCCAAGGGAACAATTTAACCGGCTCCTTTTAG


Translation (1458 aa):
MGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTGNTVQQHPSTPKRHTVLYISP
P
PEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRD
C
EESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGN
GTLDSQKGTGVKKSPMLCGQYPVKSEGKELKIVV
Q
PETQHRARYLTEGSRGSVKDRTQQGFPTVK
LEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTP
C
KEVDIEGTTVIEVGLDPSNNMTL
AVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNITRKDGST
L
TLQTPSSPILC
TQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDM
E
LFHQ
NHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAGALNVNVKKEISSPARPCS
F
EEAMK
AMKTTGCNVDKVTILPNALITPLISSSMIKTEDVTPMEVTSEKRSSPIFQTTKSIGSTQQTLET
I
SNIAGGAPFSSPSSSSHLTPESENQQQLQPKAYNPETLTTIQTQDISQPGTFPAVSAASQLPSSDALLQ
Q
ATQFQTREAQSRDTIQSDTVVNLSQLTEASQQQQSPLQEQAQTLQQQIPSNIFPSPSSVSQLQSTIQQL
Q
AGSFTGSAAGGRSGSVDLVQQVLEAQQQLSSVLFSTPDGNENVQEQLNADIFQVSQIQNSVSPGMFSSA
E
SAVHTRPDNLLPGRADSVHQQTENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSA
A
SASGSLQQSPVYQQPSHMMSALPTNEDMQMQCELFSSPPAASGNETSTTTTPQVATPGSTMFQTPSSGD
G
EETGAQAKQIQNSVFQTMVQMQRSGDSQPQVNLFSSTKNIMSVQNNGTQQQGNSLFQQGSEMMSLQSGN
F
LQQSSHSQAQLFHPQNPIADAQNLSQETQGSIFHSPNPIVHSQTSTASSEQLQPSMFHSQNTIAVLQGS
S
VPQDQQSPNIFLSQSSINNLQTNTVAQEEQISFFAAQNSISPLQSTSNTEQQAAFQQQPPISHIQTPIL
S
QEQAQPSQQGLFQPQVALGSLPPNPMPQNQQGPIFQTQRPIVGMQSNSPSQEQQQQQQQQQQQQQQQQQ
Q
QQSILFSNQNAMATMASQKQPPPNMMFSPNQNPMASQEQQNQSIFHQQSNMAPMNQEQQPMQFQNQPTV
S
SLQNPGPTQSESPQTSLFHSSPQIQLVQGSPSSQDQQVTLFLSPASMSALQTSINQPDMQQSPLYSPQN
N
IPGIQGSTSSPQPQATLFHNTTGGTINQIQNSPGSSQQTSGMFLFGIQN
NCSQLLTSGPATLPDQLMAI
N
QQGQPQNEGQSSVTTLLSQQMPETSPLASSVNSSQNMEKIDLLVSLQSQGNNLTGSF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser