NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40421.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40421.1 Public Mus musculus 8 Vps35 21 106 86 CCDS HistoryNCBI Gene:65114Re-query CCDS DB by CCDS ID:40421.1Re-query CCDS DB by GeneID:65114See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 40421.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034131 ENSMUSP00000034131 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034131Link to Ensembl Protein Viewer:ENSMUSP00000034131Re-query CCDS DB by Nucleotide ID:ENSMUST00000034131Re-query CCDS DB by Protein ID:ENSMUSP00000034131
Original member Current member EBI,WTSI OTTMUST00000149866 OTTMUSP00000077724 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000149866Link to Vega Protein Viewer:OTTMUSP00000077724Re-query CCDS DB by Nucleotide ID:OTTMUST00000149866Re-query CCDS DB by Protein ID:OTTMUSP00000077724
Original member Current member NCBI NM_022997.4 NP_075373.1 Accepted alive Link to Nucleotide Sequence:NM_022997.4Link to Protein Sequence:NP_075373.1Re-query CCDS DB by Nucleotide ID:NM_022997Re-query CCDS DB by Protein ID:NP_075373Link to BLink:NP_075373.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075373.1 796 Q9EQH3 796 100% 0 0

Chromosomal Locations for CCDS 40421.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 85261130 85261309 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85261995 85262138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85263311 85263550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85264144 85264323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85270693 85270815 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85273472 85273627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85274820 85275027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85278704 85278852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85278960 85279056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85281236 85281345 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85281841 85281924 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85283993 85284206 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85286341 85286523 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85287696 85287819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85289706 85289802 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85294859 85294957 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 85299455 85299457 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2391 nt):
ATGCCTACAACACAGCAGTCACCCCAGGATGAGCAGGAAAAACTTTTGGATGAAGCCATCCAGGCTGTGA
AG
GTTCAGTCATTCCAGATGAAAAGATGCCTGGACAAAAACAAGCTGATGGATGCTCTGAAGCATGCCTC
C
AATATGCTTGGAGAGCTCCGGACCTCTATGCTGTCACCAAAGAGTTACTATGAACTTTATATGGCTATT
TCT
GATGAACTGCACTACTTGGAGGTCTACCTGACTGATGAATTTGCTAAAGGAAGAAAGGTGGCAGATC
TC
TATGAACTTGTACAGTACGCGGGAAACATTATTCCAAGGCTTTATCTCTTGATCACAGTTGGAGTTGT
A
TATGTCAAGTCATTTCCTCAATCCAGGAAAGATATTTTGAAAGATTTGGTAGAAATGTGCCGTGGTGTG
CAG
CATCCGCTAAGGGGTTTGTTTCTTCGAAATTACCTTCTTCAGTGTACTAGGAACATTTTACCTGATG
AA
GGAGAGCCAACAGATGAAGAAACAACTGGTGATATCAGTGATTCCATGGATTTTGTACTACTCAACTT
T
GCAGAAATGAATAAGCTCTGGGTGCGGATGCAGCATCAAGGACATAGTCGAGATAGAGAAAAAAGAGAA
CGA
GAGAGACAAGAACTGAGAATTTTAGTGGGAACAAATTTGGTGCGCCTTAGTCAGTTGGAAGGTGTAA
AT
GTGGAACGTTACAAACAGATTGTTCTAACAGGCATTCTGGAGCAGGTTGTGAATTGTAGGGATGCTCT
G
GCTCAGGAGTATCTCATGGAGTGCATCATTCAGGTTTTTCCTGATGAGTTTCATCTTCAGACTTTGAAT
CCT
TTTCTTAGAGCTTGTGCTGAATTACACCAAAATGTAAATGTGAAAAACATAATCATTGCTTTAATTG
AC
AGATTAGCTTTATTTGCTCATCGTGAAGATGGACCCGGAATTCCAGCTGAGATTAAACTTTTTGACAT
A
TTTTCACAACAGGTGGCTACAGTCATACAGTCCAGACAAGACATGCCATCAGAGGATGTTGTATCTTTA
CAA
GTCTCTCTCATTAATCTTGCTATGAAATGTTACCCTGATCGTGTGGACTACGTCGATAAAGTTCTAG
AA
ACAACAGTGGAGATATTCAATAAGCTTAACCTTGAACATATTGCTACCAGTAGTGCAGTTTCAAAGGA
G
CTTACCAGACTTTTGAAGATACCTGTTGATACTTACAACAATATCTTAACAGTATTAAAGTTAAAGCAT
TTC
CACCCACTTTTTGAGTACTTTGACTACGAGTCCAGAAAGAGCATGAGCTGTTATGTGCTTAGTAATG
TT
CTGGATTATAACACAGAAATCGTCTCTCAGGACCAGGTAGATTCCATAATGAATTTGGTGTCCACATT
G
ATTCAGGATCAGCCAGACCAACCTGTAGAAGACCCTGATCCAGAAGACTTCGCTGATGAACAGAGCCTT
GTT
GGCCGATTTATTCATCTGCTACGTTCTGATGATCCTGACCAGCAGTATTTGATTTTGAATACGGCAC
GA
AAACATTTTGGGGCTGGTGGAAATCAGCGGATTCGCTTCACACTGCCACCTTTGGTATTTGCAGCTTA
C
CAGTTGGCTTTTCGATACAAAGAGAATTCCCAAATGGATGACAAGTGGGAAAAGAAATGCCAGAAGATA
TTT
TCATTTGCTCACCAGACTATCAGTGCTTTGATTAAAGCTGAGCTGGCTGAATTACCACTGAGACTTT
TT
CTTCAAGGAGCATTAGCTGCTGGAGAAATTGGCTTTGAAAATCATGAAACAGTAGCATATGAATTTAT
G
TCCCAGGCATTTTCTCTATATGAAGATGAAATCAGTGATTCTAAAGCACAGCTGGCTGCTATCACCTTG
ATC
ATCGGTACTTTTGAGAGGATGAAATGCTTCAGTGAAGAGAATCATGAACCCTTGAGAACTCAGTGTG
CA
CTTGCTGCATCAAAACTTCTGAAAAAACCAGATCAAGGCCGAGCCGTGAGCACATGTGCGCATCTCTT
T
TGGTCTGGCCGAAACACAGACAAAAATGGGGAAGAGCTTCATGGAGGTAAAAGGGTCATGGAGTGCCTA
AAG
AAGGCACTAAAAATAGCAAATCAGTGCATGGACCCCTCTCTACAAGTTCAGCTCTTTATAGAGATTC
TG
AACAGGTACATCTATTTCTATGAAAAAGAAAATGATGCGGTAACCATTCAAGTCTTGAACCAACTTAT
T
CAAAAGATTCGAGAAGATCTCCCAAATCTTGAGTCCAGTGAAGAAACAGAACAAATAAACAAGCATTTT
CAC
AACACATTGGAGCACTTGCGCTCAAGACGGGAATCACCAGAGTCTGAGGGGCCAATCTATGAAGGTC
TC
ATCCTTTAA


Translation (796 aa):
MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAI
S
DELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPR
LYLLITVGVVYVKSFPQSRKDILKDLVEMCRGV
Q
HPLRGLFLRNYLLQCTRNILPDEGEPT
DEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRE
R
ERQELRILVGTNLVRLSQLEGVNVERYKQ
IVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLN
P
FLRACAELHQNVNVKNIIIALID
RLALFAHREDGPGIPAEIKLFDIFSQQVATVIQSRQDMPSEDVVSL
Q
VSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLE
HIATSSAVSKELTRLLKIPVDTYNNILTVLKLKH
F
HPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQ
VDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSL
V
GRFIHLLRSDDPDQQYL
ILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSQMDDKWEKKCQKI
F
SFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHETVAYEFMSQ
AFSLYEDEISDSKAQLAAITL
I
IGTFERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEE
LHGGKRVMECL
K
KALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDA
VTIQVLNQLIQKIREDLPNLESSEETEQINKHF
H
NTLEHLRSRRESPESEGPIYEGLIL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser