NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40307.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40307.1 Public Mus musculus 8 Ash2l 21 106 86 CCDS HistoryNCBI Gene:23808Re-query CCDS DB by CCDS ID:40307.1Re-query CCDS DB by GeneID:23808See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40307.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000068892 ENSMUSP00000070957 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000068892Link to Ensembl Protein Viewer:ENSMUSP00000070957Re-query CCDS DB by Nucleotide ID:ENSMUST00000068892Re-query CCDS DB by Protein ID:ENSMUSP00000070957
Original member Current member EBI,WTSI OTTMUST00000055228 OTTMUSP00000026421 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000055228Link to Vega Protein Viewer:OTTMUSP00000026421Re-query CCDS DB by Nucleotide ID:OTTMUST00000055228Re-query CCDS DB by Protein ID:OTTMUSP00000026421
Original member Current member NCBI NM_011791.3 NP_035921.2 Accepted alive Link to Nucleotide Sequence:NM_011791.3Link to Protein Sequence:NP_035921.2Re-query CCDS DB by Nucleotide ID:NM_011791Re-query CCDS DB by Protein ID:NP_035921Link to BLink:NP_035921.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035921.2 623 Q91X20 623 100% 0 0

Chromosomal Locations for CCDS 40307.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 25817401 25817508 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25817604 25817663 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25818546 25818644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25819626 25819718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25822695 25822888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25823139 25823306 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25827174 25827391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25828766 25828859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25831273 25831348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25832640 25832735 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25833751 25833846 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25834960 25835054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25836000 25836088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25839743 25839888 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25840012 25840075 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25840582 25840757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1872 nt):
ATGGCGGCGGCTGGAGCGGGTCCTGGTCCGGGAGTCAGCGCCGGCCCTGGTCCCGGAGCCGCTGCAAGTG
CC
ACAACGGCGGAGGACCGAGAGACAGAGCCGGTGGCCGCGGGGGCTGGCGAGGGGCCGTCAGCCGCCCC
G
GGAGCGGAGCCCAGCTCCGGAGAGGCCGAAAGTGGGGATGCAAACTTGGTTGATGTAAGTGGTCTGGAG
ACA
GAATCTTCTAATGGAAAAGATACTTTGGAAGGTACCGGAGACACTTCAGAAGTGATGGATACCCAGG
CG
GGCTCTGTGGATGAGGAGAATGGGCGGCAGTTGGGAGAAGTGGAGTTGCAGTGTGGGATATGTACAAA
A
TGGTTCACCGCTGACACCTTTGGAATAGACACGTCGTCATGTCTGCCTTTTATGACCAACTACAGCTTC
CAT
TGCAATGTGTGCCATCACAGTGGGAATACCTACTTTCTCCGGAAGCAAGCAAATTTAAAAGAAATGT
GC
CTTAGTGCCTTGGCGAATTTGACGTGGCAGTCTCGAACACAGGATGAACATCCAAAAACCATGTTCTC
C
AAAGATAAGGATATTATACCATTTATTGATAAATACTGGGAATGTATGACAACCAGACAGAGACCTGGA
AAA
ATGACTTGGCCCAATAACATTGTCAAAACAATGAGTAAGGAAAGAGATGTGTTCTTGGTAAAGGAAC
AC
CCTGACCCAGGAAGCAAAGACCCAGAAGAAGATTACCCCAAGTTTGGACTTTTGGATCAGGATCTTAG
T
AATATTGGTCCTGCTTATGACAACCAGAAACAAAGCAGTGCTGTGTCTGCTAGTGGGAACCTAAATGGG
GGG
ATCGCAGCCGGAAGCAGTGGGAAAGGAAGAGGAGCCAAGCGTAAGCAGCAAGATGGAGGGACAACAG
GG
ACCACCAAGAAGGCCAGAAGTGATCCTTTATTTTCTGCTCAGCGTCTCCCTCCTCATGGCTATCCTTT
G
GAACATCCATTTAACAAAGATGGCTATCGGTATATTCTTGCTGAGCCCGATCCTCATGCCCCCGACCCG
GAG
AAGCTTGAACTTGACTGCTGGGCGGGAAAGCCTATTCCTGGAGACCTTTACAGAGCCTGCTTATATG
AA
CGAGTCTTGTTAGCCCTACATGATCGAGCTCCCCAGTTAAAGATCTCTGATGACCGGCTGACCGTGGT
T
GGAGAGAAGGGCTACTCCATGGTCCGGGCCTCTCATGGGGTACGCAAAGGGGCCTGGTACTTTGAAATC
ACT
GTGGATGAGATGCCCCCAGACACTGCTGCCAGGCTGGGCTGGTCCCAGCCCTTAGGTAACCTCCAAG
CT
CCCTTAGGCTATGATAAGTTTAGCTATTCTTGGCGGAGCAAGAAAGGCACCAAGTTCCACCAGTCCAT
T
GGCAAGCACTATTCGTCTGGCTACGGACAAGGGGACGTCCTAGGGTTCTATATCAACCTTCCCGAAGAC
ACA
GAGACAGCCAAGTCACTGCCGGACACCTACAAAGATAAGGCTTTGATAAAGTTCAAGAGTTATTTGT
AT
TTTGAAGAAAAAGACTTTGTGGACAAAGCAGAGAAGAGCCTAAAACAGACCCCCCATAGTGAGATAAT
A
TTTTATAAAAATGGTGTCAATCAGGGTGTGGCTTACAGAGATATTTTTGAAGGAGTTTACTTCCCAGCC
ATC
TCACTGTACAAGAGCTGCACGGTTTCCATTAACTTTGGACCATCCTTCAAATACCCTCCAAAGGATC
TC
ACGTACCACCCTATGAGTGACATGGGCTGGGGCGCTGTGGTAGAACACACACTGGCTGATGTTTTGTA
T
CACGTGGAGACAGAAGTGGACGGAAGACGTAGTCCACCCTGGGAACCCTAA


Translation (623 aa):
MAAAGAGPGPGVSAGPGPGAAASATTAEDRETEPVAAGAGEGPSAAPGAEPSSGEAESGDANLVDVSGLE
T
ESSNGKDTL
EGTGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSF
H
CNVCHHSGNTYFLRKQA
NLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPG
K
MTWPNNIVKTM
SKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSASGNLNG
G
IAAGSSGKGRGAKRKQQDGGTTGTTKKAR
SDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDP
E
KLELDCWAGKPIPGDLYRACLYERVLLALHDR
APQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEI
T
VDEMPPDTAARLGWSQPL
GNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPED
T
ETAKSLPDTYKDK
ALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPA
I
SLYKSCT
VSINFGPSFKYPPKDLTYHPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser