NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40201.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40201.1 Public Mus musculus 7 Shank2 21 106 86 CCDS HistoryNCBI Gene:210274Re-query CCDS DB by CCDS ID:40201.1Re-query CCDS DB by GeneID:210274See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40201.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000146006 ENSMUSP00000146440 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000146006Link to Ensembl Protein Viewer:ENSMUSP00000146440Re-query CCDS DB by Nucleotide ID:ENSMUST00000146006Re-query CCDS DB by Protein ID:ENSMUSP00000146440
Original member Current member EBI,WTSI OTTMUST00000039641 OTTMUSP00000076476 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039641Link to Vega Protein Viewer:OTTMUSP00000076476Re-query CCDS DB by Nucleotide ID:OTTMUST00000039641Re-query CCDS DB by Protein ID:OTTMUSP00000076476
Original member Current member NCBI NM_001081370.2 NP_001074839.2 Accepted alive Link to Nucleotide Sequence:NM_001081370.2Link to Protein Sequence:NP_001074839.2Re-query CCDS DB by Nucleotide ID:NM_001081370Re-query CCDS DB by Protein ID:NP_001074839Link to BLAST:NP_001074839.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074839.2 1262 Q80Z38-3 1262 99.9208% 0 1

Chromosomal Locations for CCDS 40201.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 144284969 144285137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144286642 144286766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144395463 144395598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144396351 144396431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144396638 144396646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144398241 144398261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144405330 144405460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144407121 144407232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144408056 144408076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144409462 144411868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 144420559 144421135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3789 nt):
ATGATGAGCGTCCCCGGCGGTGGAGCAGCCACCGTGATGATGACCGGTTACAATAATGGTCGCTATCCCC
GG
AATTCTCTCTACAGTGACTGCATTATTGAGGACAAGACGGTGGTCCTGCAAAAGAAGGACAACGAGGG
C
TTTGGATTTGTGCTCCGAGGGGCAAAAGCCGATACCCCCATTGAGGAATTCACACCCACGCCAGCATTT
CCA
GCCCTGCAGTACCTGGAGTCCGTGGATGAAGGTGGGGTGGCATGGCAAGCCGGACTAAGGACCGGGG
AC
TTCTTGATTGAGGTTAACAATGAAAATGTCGTCAAGGTGGGCCACAGGCAGGTGGTGAACATGATCCG
C
CAGGGAGGGAATCACCTCATCCTTAAGGTCGTCACGGTGACCAGGAATCTAGACCCTGATGATACAGCC
AGA
AAGAAAGCTCCCCCACCTCCAAAGCGGGCTCCGACCACGGCCCTCACCCTGCGTTCCAAGTCCATGA
CA
GCGGAGTTGGAGGAACTCGTGGACAAAGCCTCAGTCCGGAAGAAGAAGGATAAACCGGAAGAGATAGT
C
CCAGCCTCCAAGCCCTCCAGGACTGCAGAGAACGTGGCCATCGAATCCAGGGTGGCGACCATCAAGCAG
CGG
CCCACAAGCCGGTGCTTCCCAGCTGCCTCTGATGTGAATTCCGTGTACGAGCGCCAAGGGATTGCTG
TA
ATGACGCCCACGGTCCCTGGGAGCCCGAAAGGCCCATTTCTGGGCCTCCCTCGAGGTACGATGCGAAG
G
CAGAAATCGATAGACAGCAGAATCTTTCTATCAGGGATAACAGAGGAAGAGCGGCAGTTTCTGGCTCCC
CCA
ATGCTGAAGTTCACCCGAAGCTTGTCCATGCCAGACACTTCTGAGGACATCCCCCCTCCGCCACAGT
CT
GTGCCCCCCTCTCCCCCTCCTCCTTCCCCCACCACATACAACTGTCCCAGGTCCCCGACTCCAAGAGT
C
TATGGGACAATTAAGCCCGCGTTCAATCAGAACCCCGTCGTCGCCAAGGTGCCCCCAGCCACCAGGTCT
GAC
ACTGTGGCCACCATGATGCGGGAAAAGGGGATGTTCTACAGGAGAGAGCTGGACAGATTTTCCCTGG
AC
TCAGAAGACGTCTACAGCCGCAGCCCCGCCCCACAGGCCGCCTTCCGCACCAAGCGGGGACAGATGCC
T
GAGAACCCGTACTCAGAGGTGGGAAAGATAGCCAGCAAGGCCGTCTATGTCCCTGCCAAGCCAGCCAGG
CGG
AAGGGCGTGCTGGTAAAGCAGTCCAACGTGGAGGATAGCCCCGAGAAGACGTGCTCCATACCCATCC
CA
ACCATCATCGTCAAGGAACCCTCCACCAGCAGCAGCGGCAAGAGCAGCCAGGGGAGCAGCATGGAGAT
T
GACCCCCAGGCCACCGAGCCCGGCCAGCTGCGGCCAGATGACAGCCTCACCGTCAGCAGCCCCTTTGCT
GCG
GCCATCGCTGGGGCTGTGCGTGACCGGGAGAAGCGTCTGGAAGCCAGGAGGAATTCCCCAGCCTTCC
TC
TCCACCGACCTGGGAGATGAGGACGTGGGTCTGGGGCCGCCTGCTCCCCGGATGCAGGCCTCCAAGTT
C
CCAGAGGAGGGTGGGTTTGGTGACGAGGATGAGACGGAACAACCGCTGTTGCCTACCCCCGGGGCAGCA
CCC
AGGGAGCTGGAGAATCACTTCCTAGGTGGTGGTGAGGCTGGTGCTCAGGGGGAGGCTGGGGGACCCC
TG
AGTTCCACATCCAAAGCCAAGGGGCCTGAGAGTGGCCCAGCAGCCCCCCTCAAGAGCAGCAGCCCAGC
C
GGCCCTGAGAATTACGTGCACCCACTCACAGGGCGGCTGCTTGACCCCAGCTCCCCACTGGCCCTGGCA
CTC
TCAGCCAGGGACCGAGCCATGCAGGAGTCCCAGCAGGGGCACAAAGGAGAGGCCCCCAAGGCTGACC
TT
AACAAGCCTCTCTACATCGATACCAAAATGCGGCCCAGCGTGGAGTCCGGCTTTCCTCCAGTCACCAG
A
CAGAACACCAGGGGTCCCCTGCGACGGCAAGAGACAGAGAACAAGTACGAGACAGACCTGGGCAAGGAC
CGG
AGGGCGGACGACAAGAAGAACATGCTGATCAACATCGTGGACACTGCCCAGCAGAAGTCAGCTGGCC
TA
CTGATGGTGCACACAGTGGACGTCCCCATGGCCGGGCCACCCCTGGAGGAAGAGGAGGACAGAGAGGA
T
GGGGATACAAAGCCAGACCACTCACCCTCCACAGTGCCAGAAGGCGTTCCCAAAACCGAAGGTGCTTTA
CAG
ATCTCCGCTGCCCCGGAGCCCGCCGTCGCGCCCGGCAGGACCATCGTGGCGGCGGGCTCCGTGGAAG
AG
GCGGTGATTCTGCCATTCCGCATCCCCCCTCCCCCTCTGGCATCCGTGGACTTGGATGAGGACTTTCT
T
TTCACAGAACCGTTGCCTCCCCCCCTGGAATTCGCCAATAGTTTTGATATCCCCGATGACCGGGCAGCT
TCA
GTTCCCGCTCTGGCTGACCTGGTCAAGCAGAAGAAAAACGACACCTCTCAGCCCCCTACGTTGAACT
CC
AGCCAACCAGCCAACTCCACAGACAGTAAGAAGCCAGCCGGTATCTCGAACTGTCTGCCCTCCTCGTT
C
CTGCCACCCCCCGAAAGTTTCGATGCAGTCACCGACTCGGGGATTGAGGAGGTGGACAGCCGGAGTAGC
AGC
GACCACCACCTGGAGACTACCAGCACCATCTCCACGGTGTCCAGCATCTCCACGCTGTCCTCAGAGG
GC
GGCGAGAGCATGGACACCTGCACAGTCTATGCAGACGGGCAAGCCTTTGTGGTTGACAAGCCCCCAGT
A
CCTCCAAAGCCAAAAATGAAGCCCATCGTTCACAAGAGCAACGCACTTTACCAAGACACGCTCCCAGAA
GAG
GACACGGATGGCTTTGTGATCCCCCCACCTGCACCCCCGCCCCCGCCGGGCAGCGCCCAGGCCGGTG
TG
GCGAAGGTCATCCAGCCAAGGACCTCCAAGTTGTGGGGTGACGTTCCAGAGGTCAAAAGCCCAATTCT
C
TCAGGCCCAAAGGCAAATGTCATTAGTGAGCTAAACTCCATTCTGCAGCAGATGAACAGGGGGAAATCG
GTC
AAGCCCGGGGAAGGGCTGGAGCTGCCGGTGGGAGCCAAGTCGGCCAACCTCGCTCCAAGAAGCCCGG
AG
GTCATGAGCACCGTCTCAGGTACACGGAGCACGACGGTCACCTTCACTGTCCGCCCTGGCACCTCCCA
G
CCCATCACCCTGCAGAGCCGGCCCCCCGACTATGAAAGCAGAACCTCAGGACCTAGACGCGCCCCAAGC
CCT
GTGGTTTCACCAACGGAATTGAGCAAAGAGATCCTGCCCACCCCTCCCCCTCCGTCCGCCACTGCAG
CC
TCTCCCTCCCCCACACTCTCAGATGTCTTTAGCCTTCCGAGCCAGTCCCCTGCAGGGGACCTCTTTGG
C
TTGAACCCAGCAGGACGGAGCAGGTCACCATCTCCTTCAATATTGCAACAGCCAATCTCAAATAAGCCT
TTT
ACAACTAAGCCTGTCCACCTGTGGACGAAACCAGATGTGGCAGACTGGCTGGAAAGTCTGAACTTGG
GT
GAACACAAGGAGACGTTCATGGACAATGAGATTGACGGCAGCCACCTGCCAAACCTTCAGAAGGAAGA
C
TTGATAGATCTTGGGGTGACTCGAGTTGGGCATAGGATGAACATAGAAAGGGCTTTGAAACAGCTGCTG
GAC
AGATAA


Translation (1262 aa):
MMSVPGGGAATVMMTGYNNGRYPRNSLYSDCIIEDKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAF
P
ALQYLESVDEGGVAWQAGLRTGDFLIE
VNNENVVKVGHRQVVNMIRQGGNHLILKVVTVTRNLDPDDTA
R
KK
APPPPKRAPTTALTLRSKSMTAELEELVDKASVRKKKDKPEEIVPASKPSRTAENVAIESRVATIKQ
R
PTSRCFPAASDVN
SVYERQGIAVMTPTVPGSPKGPFLGLPRGTMRRQKSIDSRIFLSGITEEERQFLAP
P
MLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPRSPTPRVYGTIKPAFNQNPVVAKVPPATRS
D
TVATMMREKGMFYRRELDRFSLDSEDVYSRSPAPQAAFRTKRGQMPENPYSEVGKIASKAVYVPAKPAR
R
KGVLVKQSNVEDSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSMEIDPQATEPGQLRPDDSLTVSSPFA
A
AIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPPAPRMQASKFPEEGGFGDEDETEQPLLPTPGAA
P
RELENHFLGGGEAGAQGEAGGPLSSTSKAKGPESGPAAPLKSSSPAGPENYVHPLTGRLLDPSSPLALA
L
SARDRAMQESQQGHKGEAPKADLNKPLYIDTKMRPSVESGFPPVTRQNTRGPLRRQETENKYETDLGKD
R
RADDKKNMLINIVDTAQQKSAGLLMVHTVDVPMAGPPLEEEEDREDGDTKPDHSPSTVPEGVPKTEGAL
Q
ISAAPEPAVAPGRTIVAAGSVEEAVILPFRIPPPPLASVDLDEDFLFTEPLPPPLEFANSFDIPDDRAA
S
VPALADLVKQKKNDTSQPPTLNSSQPANSTDSKKPAGISNCLPSSFLPPPESFDAVTDSGIEEVDSRSS
S
DHHLETTSTISTVSSISTLSSEGGESMDTCTVYADGQAFVVDKPPVPPKPKMKPIVHKSNALYQDTLPE
E
DTDGFVIPPPAPPPPPGSAQAGVAKVIQPRTSKLWGDVPEVKSPILSGPKANVISELNSILQQMNRGKS
V
KPGEGLELPVGAKSANLAP
RSPEVMSTVSGTRSTTVTFTVRPGTSQPITLQSRPPDYESRTSGPRRAPS
P
VVSPTELSKEILPTPPPPSATAASPSPTLSDVFSLPSQSPAGDLFGLNPAGRSRSPSPSILQQPISNKP
F
TTKPVHLWTKPDVADWLESLNLGEHKETFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLL
D
R




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser