NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39696.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39696.1 Public Mus musculus 6 Abcc9 21 106 86 CCDS HistoryNCBI Gene:20928Re-query CCDS DB by CCDS ID:39696.1Re-query CCDS DB by GeneID:20928See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39696.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000100827 ENSMUSP00000098390 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000100827Link to Ensembl Protein Viewer:ENSMUSP00000098390Re-query CCDS DB by Nucleotide ID:ENSMUST00000100827Re-query CCDS DB by Protein ID:ENSMUSP00000098390
Original member Current member EBI,WTSI OTTMUST00000140695 OTTMUSP00000073641 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000140695Link to Vega Protein Viewer:OTTMUSP00000073641Re-query CCDS DB by Nucleotide ID:OTTMUST00000140695Re-query CCDS DB by Protein ID:OTTMUSP00000073641
Original member Current member NCBI NM_011511.2 NP_035641.1 Accepted alive Link to Nucleotide Sequence:NM_011511.2Link to Protein Sequence:NP_035641.1Re-query CCDS DB by Nucleotide ID:NM_011511Re-query CCDS DB by Protein ID:NP_035641Link to BLAST:NP_035641.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035641.1 1546 P70170-2 1546 100% 0 0

Chromosomal Locations for CCDS 39696.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 142590366 142590503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142594709 142594771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142598108 142598241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142599054 142599157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142600908 142601016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142601776 142601854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142603047 142603177 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142604830 142604950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142605819 142605920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142614414 142614516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142620683 142620775 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142625937 142626094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142627189 142627258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142627473 142627621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142628423 142628652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142633085 142633181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142639192 142639317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142639448 142639585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142644275 142644355 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142645886 142645970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142646272 142646373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142648027 142648065 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142652527 142652632 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142656603 142656675 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142658498 142658602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142664532 142664640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142671541 142671683 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142672595 142672635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142675401 142675563 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142679219 142679353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142681989 142682144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142682859 142683017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142685000 142685182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142687199 142687441 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142688964 142689130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142692781 142692902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142694477 142694618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142697679 142697820 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4641 nt):
ATGAGCCTTTCTTTTTGTGGGAACAACATCTCCTCCTACAACATCTATTATGGTGTTCTCCAAAACCCCT
GC
TTTGTGGACGCACTCAACCTGGTCCCACATGTCTTCCTGCTGTTTATCACCTTTCCAATACTGTTCAT
T
GGATGGGGGAGCCAAAGCTCAAAAGTGCAAATTCATCATAACACGTGGCTTCATTTTCCCGGACACAAC
CTG
AGATGGATTCTGACGTTTGCGCTCCTGTTTGTGCATGTTTGTGAGATAGCGGAAGGCATCGTTTCAG
AC
TCGCATCGGGCGTCCAGGCATCTCCACCTTTTCATGCCGGCTGTGATGGGATTTGTCGCCACAACAAC
G
TCCATCGTCTATTATCATAACATTGAAACATCAAATTTCCCTAAATTACTTTTAGCTTTATTCCTGTAC
TGG
GTAATGGCCTTTATTACAAAGACGATAAAGTTGGTCAAATACTGGCAGTTGGGGTGGGGAGTGTCAG
AC
CTGCGCTTCTGCATCACAGGAGTGATGGTCATCTTGAATGGGCTGCTGATGGCTGTGGAGATCAATGT
C
ATCCGGGTCAGAAGATATGTTTTCTTCATGAATCCCCAGAAAGTGAAGCCTCCGGAAGACCTCCAGGAC
CTG
GGCGTGAGGTTCCTCCAGCCATTTGTGAATTTACTGTCCAAAGCTACTTACTGGTGGATGAACACAC
TT
ATCATATCAGCTCACAGGAAACCTATCGATCTGAAGGCGATTGGAAAGTTGCCGATAGCGATGAGGGC
G
GTGACCAATTATGTCTGCCTAAAGGAAGCCTATGAAGAGCAGAAGAAAAAGGCTGCCGATCATCCAAAT
CGG
ACTCCCTCCATATGGCTGGCCATGTACAGAGCTTTTGGGAGACCAATCCTGCTGAGCAGCACATTCC
GG
TACTTGGCTGACTTGCTGGGGTTTGCTGGTCCTCTTTGTATATCTGGGATAGTCCAGCGAGTAAATGA
A
AAGACTAACACAACAAGAGAAATGTTTCCAGAGACACTCTCATCAAAGGAATTTCTGGAAAACGCCCAT
GTG
CTGGCTGTCCTGCTTTTCCTGGCCCTTATCCTACAGAGGACCTTTCTGCAGGCTTCCTACTATGTGA
CC
ATAGAGACCGGCATCAACCTCCGTGGGGCTCTGCTGGCTATGATATACAATAAAATCCTTCGGCTCTC
G
ACTTCTAACCTATCCATGGGTGAGATGACCCTGGGACAGATCAACAACTTGGTTGCCATAGAAACCAAT
CAG
CTCATGTGGTTCTTGTTCCTGTGTCCCAATCTGTGGGCCATGCCTGTTCAGATCATAATGGGGGTGA
TC
CTGCTCTACAATTTGCTTGGGTCGAGTGCACTGGTTGGCGCTGCAGTCATTGTGCTCCTTGCACCGAT
T
CAGTACTTCATTGCCACGAAGCTGGCGGAGGCTCAGAAGAGCACTCTGGATTATTCCACCGAGAGGTTG
AAG
AAGACGAATGAGATACTGAAGGGCATCAAACTCCTTAAGCTGTACGCCTGGGAGCACATTTTCTGCA
AG
AGCGTGGAGGAGACACGAATGAAGGAGCTCTCCAGCCTCAAAACCTTCGCGCTCTACACGTCACTTTC
C
ATCTTCATGAACGCAGCAATTCCCATCGCAGCTGTTCTTGCGACATTTGTGACACATGCGTACGCCAGT
GGA
AACAACCTGAAGCCTGCAGAGGCCTTTGCCTCTCTGTCTCTCTTCCACATCCTCGTCACACCGCTCT
TC
CTGCTGTCCACGGTGGTCAGATTCGCAGTCAAAGCCATCATCAGTGTTCAAAAGCTGAATGAGTTTCT
C
TTGAGCGATGAGATTGGTGAGGACAGCTGGAGGGCCGGGGAGGGCACGCTGCCTTTCGAGTCCTGTAAG
AAG
CACACCGGAGTGCAATCAAAACCAATAAACAGGAAGCAGCCTGGACGGTACCACCTGGACAGCTACG
AG
CAAGCACGGCGCCTCCGGCCCGCTGAGACGGAAGACATTGCCATAAAGGTGACAAATGGATACTTCTC
A
TGGGGCAGTGGTTTAGCTACATTGTCCAATATTGACATTCGAATTCCAACAGGTCAGCTAACCATGATT
GTA
GGCCAAGTGGGTTGTGGAAAATCATCTCTTCTCCTTGCCATCCTTGGTGAGATGCAGACCCTGGAAG
GA
AAAGTTTACTGGAACAATGTAAATGAATCTGAGCCTTCTTTTGAAGCAACCCGAAGCAGAAGCAGGTA
T
TCTGTGGCTTACGCTGCCCAGAAGCCTTGGCTCCTAAATGCTACAGTTGAGGAAAATATCACTTTTGGA
AGT
CCTTTCAACAGACAGAGGTACAAGGCTGTCACCGATGCCTGCTCTCTTCAGCCAGACATTGATTTGC
TA
CCATTTGGAGACCAAACTGAAATCGGAGAGAGGGGCATCAACCTGAGTGGGGGTCAGAGGCAGAGAAT
C
TGCGTGGCACGGGCACTCTACCAAAACACCAACATCGTCTTTTTGGACGACCCATTCTCTGCCCTGGAC
ATC
CACCTGAGCGATCATTTGATGCAGGAAGGAATCCTGAAGTTTCTCCAGGATGACAAGAGGACGGTTG
TT
CTTGTGACGCACAAACTGCAGTACCTGACGCACGCTGACTGGATCATAGCCATGAAGGATGGCAGTGT
G
TTAAGGGAAGGGACTTTGAAAGACATTCAGACCAAAGACGTGGAGCTTTATGAACACTGGAAAACCCTC
ATG
AATAGACAGGATCAAGAATTAGAAAAGGACATGGAAGCAGACCAAACAACACTGGAGAGGAAGACTC
TC
CGGAGAGCCATGTATTCAAGAGAGGCCAAGGCACAGATGGAGGATGAAGATGAAGAGGAGGAAGAGGA
G
GAAGATGAGGAAGATAACATGTCAACGGTGATGAGGCTCAGGACCAAGATGCCCTGGAAGACCTGCTGG
TGG
TACCTCACTTCAGGAGGGTTTTTTCTGCTCTTCCTCATGATCTTCTCCAAGCTTTTGAAGCACTCGG
TG
ATTGTGGCTATAGACTACTGGCTAGCTACGTGGACATCCGAATACAGTATAAACCATCCTGGAAAAGC
T
GACCAGACCTTCTATGTGGCTGGGTTCAGCATCCTCTGTGGAGCAGGCATTTTCCTTTGCCTCGTCACC
TCC
CTCACCGTGGAATGGATGGGCCTCACAGCCGCCAAGAACCTCCACCACAACCTCCTCAATAAGATAA
TT
CTCGGGCCAATAAGGTTCTTTGATACCACACCGCTGGGGCTGATCCTCAATCGGTTTTCTGCTGATAC
G
AACATCATCGACCAGCATATCCCTCCGACCTTGGAGTCGCTGACGCGCTCCACCCTGCTCTGCCTGTCT
GCT
ATTGGGATGATCTCCTATGCTACACCCGTGTTTCTCGTCGCCCTTGCGCCCCTGGGTGTAGCCTTTT
AT
TTCATCCAGAAATACTTCCGGGTTGCCTCTAAGGATCTCCAGGAACTTGACGACAGCACCCAGCTCCC
C
CTGCTTTGTCACTTCTCAGAAACAGCTGAAGGGCTCACCACTATCCGGGCCTTCAGGCATGAAACCAGA
TTC
AAGCAACGCATGCTGGAGCTGACAGACACGAACAACATTGCCTACTTATTTCTCTCAGCAGCCAACA
GA
TGGCTGGAGGTCAGGACGGACTATCTGGGAGCGTGCATTGTTCTGACAGCCTCCATTGCATCCATTAG
T
GGCTCTTCCAACTCTGGACTGGTGGGCTTGGGCCTTCTCTATGCCCTCACGATAACCAATTACCTAAAT
TGG
GTTGTAAGGAACTTGGCCGACCTGGAAGTCCAGATGGGTGCAGTGAAGAAAGTGAACAGTTTCTTGA
CT
ATGGAGTCCGAGAACTATGAAGGCACCATGGATCCTTCTCAAGTCCCAGAGCACTGGCCACAGGAAGG
C
GAGATCAAGATTCACGATCTGTGTGTCAGATATGAAAATAACCTGAAGCCCGTTCTGAAACATGTCAAG
GCT
TACATCAAACCCGGGCAGAAGGTGGGCATCTGTGGTCGAACTGGCAGTGGGAAGTCCTCCTTATCCC
TG
GCTTTCTTCAGAATGGTCGACATATTTGACGGAAAGATAGTCATTGATGGGATAGACATCTCCAAACT
G
CCCTTGCACACGCTCCGCTCCAGGCTGTCCATCATTCTCCAGGACCCAATCCTGTTCAGCGGCTCCATC
AG
G
TTTAACCTGGATCCTGAATGCAAGTGCACAGATGACAGGCTCTGGGAGGCTCTAGAAATTGCCCAGC
TG
AAGAATATGGTCAAATCTCTGCCCGGAGGCTTAGATGCCACTGTCACCGAAGGTGGTGAGAACTTCAG
T
GTTGGACAGAGACAGCTGTTCTGCCTGGCCAGGGCCTTTGTTCGGAAGAGCAGTATACTCATCATGGAT
GAA
GCCACTGCTTCCATCGACATGGCCACGGAAAACATTTTGCAGAAAGTAGTCATGACAGCCTTTGCGG
AT
CGCACGGTCGTAACCATAGCTCATCGGGTTCACACCATTCTGACTGCAGACCTGGTTATTGTGATGAA
G
AGAGGAAATATTTTGGAATACGACACCCCGGAAAGCCTCTTGGCCCAGGAAGATGGAGTGTTTGCCTCG
TTT
GTCCGTGCAGACATGTGA


Translation (1546 aa):
MSLSFCGNNISSYNIYYGVLQNPCFVDALNLVPHVFLLFITFPILFIGWGSQSSKVQIHHNTWLHFPGHN
L
RWILTFALLFVHVCEIAEGIVSD
SHRASRHLHLFMPAVMGFVATTTSIVYYHNIETSNFPKLLLALFLY
W
VMAFITKTIKLVKYWQLGWGVSDLRFCITGVMVILNGLLMAVEINVIRVR
RYVFFMNPQKVKPPEDLQD
L
GVRFLQPFVNLLSKATYWWMNTLIISAHRKPIDLKAIGKLPIAMRAVTNYVCLKEAYEEQK
KKAADHPN
R
TPSIWLAMYRAFGRPILLSSTFRYLADLLGFAGPLCISGIVQRVNEKTNTTR
EMFPETLSSKEFLENAH
V
LAVLLFLALILQRTFLQASYYVTIETGINLRGALL
AMIYNKILRLSTSNLSMGEMTLGQINNLVAIETN
Q
LMWFLFLCPNLWAMPVQ
IIMGVILLYNLLGSSALVGAAVIVLLAPIQYFIATKLAEAQKSTLDYSTERL
K
KTNEILKGIKLLKLYAWEHIFCKSVEETRMKELSSLKTFALYTSLS
IFMNAAIPIAAVLATFVTHAYAS
G
NNLKPAEAFASLSLFHILVTPLFLLSTVVRFAVKAII
SVQKLNEFLLSDEIGEDSWRAGEGTLPFESCK
K
HTGV
QSKPINRKQPGRYHLDSYEQARRLRPAETEDIAIKVTNGYFSWGSGLATLSNIDIRIPTGQLTMI
V
GQVGCGKSSLLLAILGEMQTLEGKVYWN
NVNESEPSFEATRSRSRYSVAYAAQKPWLLNATVEENITFG
S
PFNRQ
RYKAVTDACSLQPDIDLLPFGDQTEIGERGINLSGGQRQRICVARALYQNTNIVFLDDPFSALD
I
HLSDHLMQEGILKFLQDDKRTVVLVTHKLQYLTHADW
IIAMKDGSVLREGTLKDIQTKDVELYEHWKTL
M
NRQDQELEK
DMEADQTTLERKTLRRAMYSREAKAQMEDEDEEEEEEEDEEDNMSTVMRLRTKMPWKTCW
W
YLTSGGFFLLFLMIFSKLLKHSVIVAIDYWLATWTSEYSINHPGKADQ
TFYVAGFSILCGAGIFLCLVT
S
LTVEWMGLTAAKNLHHNLLNKIILGPI
RFFDTTPLGLILNRFSADTNIIDQHIPPTLESLTRSTLLCLS
A
IGMISYATPVFLVALAPLGVAFYFIQKYFRVAS
KDLQELDDSTQLPLLCHFSETAEGLTTIRAFRHETR
F
KQRMLELTDTNNIAYLFLSAANRWLEVRT
DYLGACIVLTASIASISGSSNSGLVGLGLLYALTITNYLN
W
VVRNLADLEVQMGAVKKVNSFLTMESENYEGTM
DPSQVPEHWPQEGEIKIHDLCVRYENNLKPVLKHVK
A
YIKPGQK
VGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGIDISKLPLHTLRSRLSIILQDPILFSGSI
R
FNLDPECKCTDDRLWEALEIAQLKNMVKSLPGGLDATVTEGGENFSVGQRQLFCLARAFVRKSSILIMD
E
ATASIDMAT
ENILQKVVMTAFADRTVVTIAHRVHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFAS
F
VRADM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser