NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39587.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39587.1 Public Mus musculus 6 Grm7 21 106 86 CCDS HistoryNCBI Gene:108073Re-query CCDS DB by CCDS ID:39587.1Re-query CCDS DB by GeneID:108073See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39587.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000172951 ENSMUSP00000133957 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000172951Link to Ensembl Protein Viewer:ENSMUSP00000133957Re-query CCDS DB by Nucleotide ID:ENSMUST00000172951Re-query CCDS DB by Protein ID:ENSMUSP00000133957
Original member Current member EBI,WTSI OTTMUST00000096872 OTTMUSP00000054181 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000096872Link to Vega Protein Viewer:OTTMUSP00000054181Re-query CCDS DB by Nucleotide ID:OTTMUST00000096872Re-query CCDS DB by Protein ID:OTTMUSP00000054181
Original member Current member NCBI NM_177328.3 NP_796302.2 Accepted alive Link to Nucleotide Sequence:NM_177328.3Link to Protein Sequence:NP_796302.2Re-query CCDS DB by Nucleotide ID:NM_177328Re-query CCDS DB by Protein ID:NP_796302Link to BLAST:NP_796302.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_796302.2 915 Q68ED2 915 100% 0 0

Chromosomal Locations for CCDS 39587.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 110645868 110646386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 110914327 110914543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111066762 111066903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111080319 111080473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111207743 111207883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111246175 111246375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111253993 111254132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111358145 111359080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111495653 111495899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 111566018 111566067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2748 nt):
ATGGTCCAGCTGGGGAAGCTGCTCCGCGTCCTGACTTTGATGAAGTTCCCCTGCTGCGTGCTGGAGGTGC
TC
CTGTGCGTGCTGGCGGCGGCGGCGCGCGGCCAGGAGATGTACGCCCCGCACTCGATCCGGATCGAGGG
G
GACGTCACCCTTGGGGGGCTGTTCCCAGTGCACGCCAAGGGTCCCAGCGGAGTGCCCTGCGGCGACATC
AAG
AGGGAGAATGGGATCCACAGGCTGGAAGCTATGCTTTATGCTCTCGACCAGATCAACAGCGATCCCA
AC
CTGCTGCCCAACGTAACGTTAGGCGCGCGGATCCTGGACACTTGTTCCAGGGACACTTATGCGCTCGA
A
CAGTCGCTCACTTTCGTCCAGGCGCTTATCCAGAAGGACACCTCCGACGTGCGTTGCACCAACGGAGAG
CCC
CCGGTTTTCGTCAAGCCAGAGAAAGTAGTTGGAGTGATTGGGGCTTCGGGGAGCTCCGTCTCCATCA
TG
GTAGCCAACATCTTGAGGCTTTTCCAGATACCTCAGATTAGTTATGCATCCACGGCTCCTGAACTCAG
T
GATGACCGTCGCTATGACTTCTTCTCTCGCGTGGTCCCACCTGATTCCTTCCAAGCCCAAGCTATGGTA
GAC
ATTGTAAAGGCATTGGGCTGGAATTATGTATCTACTCTTGCATCTGAAGGAAGCTATGGAGAGAAAG
GT
GTGGAGTCCTTCACACAAATTTCCAAAGAAGCAGGTGGACTCTGCATTGCCCAGTCCGTGAGAATTCC
C
CAAGAACGCAAAGACAGGACCATTGACTTTGATAGAATTATCAAACAGCTCTTGGACACCCCCAACTCC
AGG
GCTGTCGTGATTTTTGCCAACGATGAGGATATAAAGCAGATCCTTGCAGCAGCCAAAAGAGCTGACC
AA
GTAGGACATTTTCTCTGGGTTGGGTCAGACAGCTGGGGTTCCAAAATCAACCCACTGCATCAGCATGA
A
GATATTGCAGAAGGAGCCATCACCATCCAACCTAAGAGAGCGACTGTGGAAGGATTTGATGCTTACTTC
ACA
TCCCGGACACTTGAAAACAACAGGAGAAATGTATGGTTTGCCGAATACTGGGAAGAAAACTTCAACT
GC
AAGTTGACAATTAGTGGATCCAAAAAAGAAGACACGGATCGCAAATGCACAGGACAGGAGCGAATTGG
A
AAAGACTCTAATTATGAGCAGGAGGGTAAAGTACAGTTTGTGATCGATGCTGTCTATGCCATGGCACAT
GCC
CTTCATCACATGAATAAGGATCTGTGTGCTGACTACCGGGGAGTGTGCCCAGAAATGGAGCAAGCAG
GG
GGCAAGAAGTTGTTGAAGTATATCCGCAATGTTAACTTCAATGGTAGTGCTGGAACCCCAGTGATGTT
T
AACAAAAATGGTGATGCTCCAGGACGATATGACATCTTCCAGTACCAGACAACAAACACTACCAATCCT
GGT
TATCGTCTCATTGGGCAGTGGACAGATGAACTGCAGCTCAATATAGAGGACATGCAGTGGGGCAAAG
GA
GTCCGGGAGATCCCACCCTCTGTGTGCACATTGCCATGCAAGCCTGGGCAGAGGAAGAAGACACAGAA
G
GGAACCCCTTGCTGCTGGACTTGTGAGCCCTGTGATGGATACCAGTATCAATTTGATGAGATGACATGT
CAG
CATTGTCCCTATGACCAGAGGCCCAATGAGAACCGAACTGGCTGTCAGAACATCCCAATCATCAAAC
TG
GAGTGGCACTCCCCCTGGGCTGTAATTCCTGTCTTCCTGGCAATGTTGGGGATCATTGCCACCATCTT
T
GTCATGGCAACCTTCATCCGCTACAATGATACACCCATCGTCAGGGCATCTGGGCGGGAACTCAGCTAT
GTT
TTATTGACAGGCATCTTTCTCTGCTATATCATCACCTTCCTAATGATTGCCAAGCCAGATGTGGCAG
TG
TGTTCCTTCCGACGTGTCTTCTTGGGGTTGGGTATGTGTATTAGTTATGCAGCCCTTTTAACAAAAAC
C
AATCGGATTTATCGCATATTCGAGCAGGGCAAGAAATCGGTGACAGCTCCCAGACTCATAAGCCCAACA
TCA
CAACTGGCAATTACCTCCAGTTTAATATCGGTGCAACTTCTAGGTGTCTTTATTTGGTTTGGGGTTG
AC
CCACCCAACATCATCATAGACTACGATGAGCATAAGACAATGAACCCAGAACAAGCCAGGGGAGTTCT
C
AAATGTGACATCACAGACCTTCAGATCATTTGTTCTTTGGGATATAGCATTCTTCTCATGGTCACATGT
ACT
GTGTATGCCATCAAGACTCGGGGTGTACCAGAGAATTTTAATGAAGCCAAGCCCATTGGATTCACTA
TG
TACACGACTTGTATCGTATGGCTTGCCTTCATCCCAATATTTTTTGGCACAGCGCAATCAGCAGAAAA
G
CTCTACATACAAACCACCACGCTTACAATCTCCATGAACCTAAGTGCATCAGTGGCGCTGGGGATGCTA
TAC
ATGCCGAAAGTGTACATCATCATTTTCCACCCTGAACTCAATGTCCAGAAACGGAAGCGAAGCTTCA
AG
GCCGTAGTCACAGCAGCCACCATGTCATCGAGGCTGTCACACAAACCCAGTGACAGGCCCAATGGTGA
G
GCAAAGACAGAACTTTGTGAAAATGTAGACCCAAACAGCCCTGCTGCAAAAAAGAAGTATGTCAGTTAT
AAT
AACCTGGTTATCTAA


Translation (915 aa):
MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDI
K
RENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGE
P
PVFVKPEKVVGVIGASGSSVSIMVANILRLFQ
IPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMV
D
IVKALGWNYVSTLASEGSYGEKGVESFTQISKEA
GGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNS
R
AVVIFANDEDI
KQILAAAKRADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYF
T
SRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDRKCT
GQERIGKDSNYEQEGKVQFVIDAVYAMAH
A
LHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFN
GSAGTPVMFNKNGDAPGRYDIFQYQTTNTTNP
G
YRLIGQWTDELQLN
IEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQYQFDEMTC
Q
HCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSY
V
LLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPT
S
QLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTC
T
VYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEK
LYIQTTTLTISMNLSASVALGML
Y
MPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPN
SPAAKKKYVSY
N
NLVI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser