NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39527.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39527.1 Public Mus musculus 6 Ccdc142 21 106 86 CCDS HistoryNCBI Gene:243510Re-query CCDS DB by CCDS ID:39527.1Re-query CCDS DB by GeneID:243510See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 39527.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101254 ENSMUSP00000098812 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101254Link to Ensembl Protein Viewer:ENSMUSP00000098812Re-query CCDS DB by Nucleotide ID:ENSMUST00000101254Re-query CCDS DB by Protein ID:ENSMUSP00000098812
Original member Current member EBI,WTSI OTTMUST00000059411 OTTMUSP00000028892 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059411Link to Vega Protein Viewer:OTTMUSP00000028892Re-query CCDS DB by Nucleotide ID:OTTMUST00000059411Re-query CCDS DB by Protein ID:OTTMUSP00000028892
Original member Current member NCBI NM_001081266.1 NP_001074735.1 Accepted alive Link to Nucleotide Sequence:NM_001081266.1Link to Protein Sequence:NP_001074735.1Re-query CCDS DB by Nucleotide ID:NM_001081266Re-query CCDS DB by Protein ID:NP_001074735Link to BLAST:NP_001074735.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074735.1 738 Q8CAI1-1 738 100% 0 0

Chromosomal Locations for CCDS 39527.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 83101684 83102638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83102958 83103044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83103120 83103269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83103402 83103532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83103612 83103725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83107053 83107167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83107455 83107632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83107755 83107954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 83108091 83108377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2217 nt):
ATGGCACGGGCGTCCAGCTCTAGTGGCCCTTTGCCTCCACTCGCTAACGTACCCTCGTCGTGGGCGCAGC
CC
GTGGGCGCTGGGGAGGAGCGGGACGAGGGGAGGCGTGGAGGGCTAGGGCTACTGGCTGCGGTGAGCGT
C
CCGTGCCCGGACTTCAGCAGACAGCCGTGGGCTCCCGCGTCTGCAAGCGGCCCGATGCCCTTCGCTCTT
CAG
CGGCTCCGGGCCACATTGCTTCGTCTGCACCGCGAGCGAGAGCAGCTCCTGCGGGCCCGGGACTGCG
CC
CGCCACCTGCAGGCGGTCGTGCGGCTGCTCCGCTCCGGCTCCTCGGCCGGTTCCCTCTCCCTGCAGCA
G
TTGCACGGCGATTTACAGCTGTGCCCATCTCGTGGGGCGGCTCTGCGCCTCGGCTTCCCGGGCTCCAGG
GAG
ACGCTTCTCCTGACTCGCCCTGTCGGGCTAGCTGCCCAGCACTTGGAGGCTGCCATCGAGATGCAGC
TT
CGTTCACTGGGCCGGACACCCGCTAGCCTGGGCCTGACATCCCAGCTAGCCGAACTGTTGCTGGCCCT
T
CCCTTCTACCACACTCTGCAGGGACATTCCCTGAACTTCGTCCCCGGGGCCGCGCGCCCATTCCCCGCG
GCC
CGTGTGCTCCAGCTCCTGGCTGCAGAGCGGGGTTGTCAGGTGGCAGATAAGCTGGCTGAAGCCCGTG
GC
GGATCGGGCTTGCAGGAGCAGCTCCGTCGGCAGTGCGAGCAAGAGCGAGAGCTGCTGCCCGGGCTGCT
G
GGCCTGGTAGGGGGCGTGGCTAGCACCGACAGCAGCGGACTGAGGCTTGGGGGACCTGGAGCCCTGTGG
AGC
CAGTATTGGACCTTGCTGTGGGCAGCCTGTGCTAAGTGTTTGGACCTACGCGTGGGACCCTGGGAGG
AC
CCTAGAGCAATGGCACAAGAGCTGAGTCAGGCACTGTGTCAAGCACCCCTGCCTCAGGAGTGTGAGAA
G
GAGCTGTTGTCTCTGTGTCACAGCCTGTTTCACCAGTCTGTCATCTGCAGCTGGGACCAAGGGTTCTGC
CAG
GCCTTAGGATCAGCCCTGGGTGGTCAGAGCAGCCCTGCGTCACTGTCTCCTACCTCTGAGCTGCTGC
AG
CGGCTTTTTCCTCCCCTCTTGGATAGCCTTCGACAGCCCAGGCCAGAACTTAGGCTGTGTCCGCCTGC
A
GGTCCTACGCCTGTCGCTCTGGGGCTCTGTACCCTGCAGACCACCTTGCTCTGGTTTGTGGGCAGAGCT
CAG
CAGCACCTGGCAGCGTGGGACCCCGGTTCCTTCTTGCTCCTGCTCCAGAAGGATCTGCCTCCTCTTC
TG
TCTGCGGTGGAGGCGCTGTCCAGCCTGGCCTCCGAAGCAGCGCTCACTCTGGAGGTGGAGCAGCAGCT
G
GGCCTAGAGATCCACAATTTGACTGAAAAGATGCAGCTCCTGCCCAAAGAATCACTGGGTCTGTTTGTC
CAA
GAATGCCATAAACAAGCCACACAAGGCTTCAAGCTCCACATGCCGAGGGGTCGATACTGGAGACTTC
GA
TTGTGTCCTGAACCTCCCAGTGACCCTAGTGAGTACGCTCGGATAGTGGTCTACTCTGTGTTGGAGCC
T
GTGTTGCAAGGACTTCAGGGATTGCCACCTGAAGCCCAAGCCCCTGCCCTCGGCCAGGCACTGACAGCC
ACA
CTGGGCGCCTGGCTTGACCACATCCTCACCCATGGGATCCGGTTCAGCCTGCAGGGGGCGCTGCAGC
TC
AAGCAAGACTTCGGAGTGGTCAGGGAGGTTCTGGAACAAGAGCAGTGGGGCCTGTCGCAGGAGCTTCG
C
CAGACTCTGCTCTCACTCAGCATCTTCCAGCAGCTAGATGGGGCCCTGCTGTGTCTCCTGCAGCAACCC
CTG
CCCAAGAATCCAGTCCACAGAAGACCTCCCCGTTGCTGTCTCTGTTATGAGGTCCAGACCACTGAAC
TG
CCCACCAGCAGCCTCAACAGCCTGGAAAACTTGGCACCCCCTCTTCGTCTTGGAGTCTCCCCTGCCCA
G
AACACTCACCTGCTAAGCACCCTGGGGGGAGGAGGACGAGGAGGAGGGGGAGGGGGAGGACCAGGACCT
AGT
CCTGAGGCTTACCTGGTGGGAAACCAGCAAGCCTGGCTTGCCCTGAGGCTGCACCAACACCCACGTT
GG
CACCTGCCTTTTTTTTCTTGCCTGAGGACAAGTCCTGAACCCTAA


Translation (738 aa):
MARASSSSGPLPPLANVPSSWAQPVGAGEERDEGRRGGLGLLAAVSVPCPDFSRQPWAPASASGPMPFAL
Q
RLRATLLRLHREREQLLRARDCARHLQAVVRLLRSGSSAGSLSLQQLHGDLQLCPSRGAALRLGFPGSR
E
TLLLTRPVGLAAQHLEAAIEMQLRSLGRTPASLGLTSQLAELLLALPFYHTLQGHSLNFVPGAARPFPA
A
RVLQLLAAERGCQVADKLAEARGGSGLQEQLRRQCEQERELLPGLLGLVGGVASTDSSGLRLGGPGALW
S
QYWTLLWAACAKCLDLRVGPWEDPRAMAQELSQALCQ
APLPQECEKELLSLCHSLFHQSVICSWDQGFC
Q
ALGSALGGQSSPASLSPTSELLQRLFPPLLDSLRQPRPELRLCPPA
GPTPVALGLCTLQTTLLWFVGRA
Q
QHLAAWDPGSFLLLLQKDLP
PLLSAVEALSSLASEAALTLEVEQQLGLEIHNLTEKMQLLPKESLGLFV
Q
ECHKQATQGFKLHMPRGRYWRLRLCP
EPPSDPSEYARIVVYSVLEPVLQGLQGLPPEAQAPALGQALTA
T
LGAWLDHILTHGIRF
SLQGALQLKQDFGVVREVLEQEQWGLSQELRQTLLSLSIFQQLDGALLCLLQQP
L
PKNPVHRRPPRC
CLCYEVQTTELPTSSLNSLENLAPPLRLGVSPAQNTHLLSTLGGGGRGGGGGGGPGP
S
PEAYLVGNQQAWLALRLHQHPRWHLPFFSCLRTSPEP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser