NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39305.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39305.1 Public Mus musculus 5 Gtf2ird1 21 106 86 CCDS HistoryNCBI Gene:57080Re-query CCDS DB by CCDS ID:39305.1Re-query CCDS DB by GeneID:57080See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39305.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000073161 ENSMUSP00000072904 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073161Link to Ensembl Protein Viewer:ENSMUSP00000072904Re-query CCDS DB by Nucleotide ID:ENSMUST00000073161Re-query CCDS DB by Protein ID:ENSMUSP00000072904
Original member Current member EBI,WTSI OTTMUST00000137913 OTTMUSP00000072563 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000137913Link to Vega Protein Viewer:OTTMUSP00000072563Re-query CCDS DB by Nucleotide ID:OTTMUST00000137913Re-query CCDS DB by Protein ID:OTTMUSP00000072563
Original member Current member NCBI NM_020331.3 NP_065064.2 Accepted alive Link to Nucleotide Sequence:NM_020331.3Link to Protein Sequence:NP_065064.2Re-query CCDS DB by Nucleotide ID:NM_020331Re-query CCDS DB by Protein ID:NP_065064Link to BLink:NP_065064.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065064.2 1072 Q9JI57-2 1072 100% 0 0

Chromosomal Locations for CCDS 39305.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 134357828 134357896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134358988 134359118 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134360238 134360275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134360954 134361146 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134361669 134361746 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134362511 134362548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134363182 134363374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134363902 134363979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134366836 134366916 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134376107 134376135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134376894 134377077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134379937 134380020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134382530 134382586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134382781 134382830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134383740 134383923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134385019 134385084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134385790 134385837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134388434 134388523 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134389131 134389211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134389674 134389711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134390822 134390930 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134392395 134392420 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134395617 134395800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134402111 134402194 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134403732 134403821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134404656 134404966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134409127 134409310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134410954 134411109 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134415135 134415276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 134417053 134417175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3219 nt):
ATGGCCTTGCTGGGGAAGCACTGTGACATCCCCACCAACGGCTGTGGGTCTGAGCGCTGGAACTCCACCT
TC
GCCCGCAAGGACGAACTCATCAACAGTCTGGTGTCCGCCTTAGACTCCATGTGCTCGGCGCTCTCCAA
G
CTGAACACGGAGGTGGCCTGCGTGGCGGTACACAATGAGAGCGTCTTCGTGATGGGCACCGAGAAGGGA
AGG
GTGTTTCTGAACACTCGGAAGGAGCTACAGTCAGACTTCCTCAGGTTCTGCCGGGGACCCCTGTGGA
AC
GATCCAGAAGCAGGACACCCTAAAAAGGTGCAGCGCTGTGAAGGCGGTGGCCGGAGCCTCCCGCGGTC
C
TCTCTGGAGCAGTGCTCGGATGTGTACCTGCTGCAGAAGATGGTAGAGGAAGTGTTTGATGTTCTTTAT
A
GT
GAGGCTATGGGCAGGGCCACCGTGGTACCTTTGCCCTATGAGAGGCTGCTCAGGGAGCCGGGGCTAC
TG
GCGGTGCAGGGGCTGCCCGAGGGCCTGGCCTTCCGGAGGCCAGCAGAGTATGACCCCAAGGCACTCAT
G
GCCATATTGGAGCACAGTCACCGAATTCGGTTTAAGCTCAGGAGGCCTCCTGATGACGGTGGGCAGGAC
ACG
AAGGCGCTGGTGGAGATGAACGGTATCTCTCTGCTACCCAAGGGGTCCCGAGACTGTGGTCTGCATG
GC
CAGGCCTCCAAGGTCGCTCCCCAAGACCTGACCCCCACCGCCACCCCATCCTCTATGGCCAACTTCCT
G
TACAGCACTTCGATGCCCAACCACACGATCCGGGAACTCAAGCAGGAGGTGCCAACCTGCCCGTTGACC
CCC
AGCGACCTGGGCATGGGCTGGCCCGTGCCTGAGCCCCATGTCCCCAGCACCCAAGATTTCTCTGATT
GC
TGTGGACAGACGCCTGCAGGGCCTGCTGGGCCTCTCATCCAGAATGTCCATGCTTCCAAGCGCATCCT
C
TTCTCCATCGTCCATGACAAGTCAGAGAAGTGGGATCCCTTCATCAAGGAAATGGAGGACATCAATACC
CTG
CGGGAGTGCGTGCAGATTCTGTTTAACAGCAGATACGCGGAAGCCCTGGGCCTGGACCACATGGTCC
CT
GTGCCCTATAGGAAGATTGCCTGTGACCCCGAGGCTGTGGAAATTGTGGGTATTCCAGACAAGATCCC
C
TTCAAGCGACCCTGTACTTACGGAGTGCCGAAGCTGAAGAGGATTCTGGAGGAGCGACACAGCATTCAC
TTC
ATTATCAAGAGAATGTTCGATGAGCGCATTTTCACAGGGAACAAGTTTACCAAAGACCCCATGAAGC
TG
GAGCCAGCTAGCCCACCAGAAGACACTTCCACAGAAGTCTGTAGGGACAGCATGCTGGACCTGGCTGG
G
ACTGCTTGGTCAGACATGAGCAGCGTCTCTGAAGACTGTGGGCCAGGAACCTCAGGAGAGATAGCAATG
TTG
AGGCCTATCAAAATCGAGCCAGAGGAGCTGGACATTATTCAGGTTACGGTCTCAGATCCTTCACCTA
CC
TCTGAGGAGATGACTGACTCGTTACCTGGGCATCTGCCCTCAGAGGATTCCGGTTATGGGATGGAAAT
G
CCGGCTGACAAAGGCCCCAGTGAAGAACCGTGGTCAGAAGAGAGGCCGGCCGAAGAGAGCCCTGGTGAC
GTG
ATCCGGCCCCTACGGAAGCAGGTGGAGATGCTGTTCAACACGAAATATGCCAAAGCTATTGGTACCT
CA
GAGCCGGTCAAGGTGCCCTACTCCAAGTTCCTGATGCACCCGGAGGAGCTGTTCGTACTGGGACTGCC
T
GAAGGCATCTCTCTTCGGAGACCCAACTGCTTTGGGATTGCAAAGCTGCGGAAGATTCTGGAAGCGAGC
AAC
AGCATCCAGTTTGTCATCAAGAGACCCGAACTGCTCACTGACGGTGTCAAAGAACCTGTTCTGGACA
CT
CAAGAGAGGGACTCCTGGGACCGTCTTGTGGACGAGACCCCGAAGAGACAGGGCCTTCAAGAAAATTA
C
AACACCAGACTCTCGCGGATCGACATCGCCAACACGCTTAGGGAACAAGTCCAAGACCTGTTTAACAAG
AAA
TACGGTGAAGCTCTGGGCATCAAATACCCAGTGCAGGTGCCCTACAAGAGAATCAAAAGCAACCCAG
GC
TCGGTAATCATTGAAGGCCTACCCCCCGGGATCCCATTCCGCAAACCCTGCACCTTTGGCTCCCAGAA
C
CTGGAAAGGATTCTCTCTGTGGCTGACAAGATCAAGTTCACGGTCACCAGGCCATTCCAAGGACTTATC
CCA
AAGCCTGAAACCAAAATTCTCACTACAGGACATGAAGCTGGGAAAACCACCAGACCAAGGAGACTGC
AA
CAGGACACCTGGCAGCCAGATGAGGATGATGCCAACAGACTGGGGGAGAAGGTGATCCTCCGAGAGCA
G
GTGAAGGAGCTCTTCAATGAGAAATACGGTGAGGCCCTGGGACTGAATCGGCCTGTGCTGGTCCCTTAC
AAA
CTGATCCGGGACAGCCCAGATGCCGTGGAGGTGAAGGGCCTCCCAGATGACATCCCCTTCCGGAACC
CC
AACACCTATGACATCCATCGGCTGGAGAAGATCCTGAAGGCCAGGGAGCATGTGCGGATGGTCATCAT
C
AACCAGCTCCAACCCTTTGCGGAAGTCTGCAATGACCCCAAGGTGCCAGAGGAGGATGACTCTAACAAG
CTC
GGGAAGAAGGTGATCCTCCGAGAGCAGGTGAAGGAGCTCTTCAATGAGAAATACGGTGAGGCCCTGG
GA
CTGAATCGGCCTGTGCTGGTCCCTTACAAACTGATCCGGGACAGCCCAGATGCCGTGGAGGTGAAGGG
C
CTCCCAGATGACATCCCCTTCCGGAACCCCAACACCTATGACATCCATCGGCTGGAGAAGATCCTGAAG
GCC
AGGGAGCATGTGCGGATGGTCATCATCAACCAGCTCCAACCTTTTGGGGACGTCTGCAACAATGCCA
AG
GTGCCAGCCAAAGACAACATTCCCAAGCGCAAGAGAAAGAGGGTCTCTGAAGGCAACTCAGTCTCCTC
T
TCTTCCTCCTCTTCATCTTCGTCCTCTAACCCAGAGTCTGTGGCATCCACCAACCAGATCTCCCTCGTG
CAG
TGGCCAGTGTACATGGTGGACTATTCCGGACTAAACGTGCAGCTTCCGGGCCCCCTTGATTATTAG


Translation (1072 aa):
MALLGKHCDIPTNGCGSERWNSTFARKDELINSLVSALDSMCSALSKLNTEVACVAVHNESVFVMGTEKG
R
VFLNTRKELQSDFLRFC
RGPLWNDPEAGHPKKVQRCEGGGRSLPRSSLEQCSDVYLLQKMVEEVFDVLY
S
EAMGRATVVPLPYERLLREPGLLAVQGLPEGLAFRRPAEYDPKALMAILEHSHRIRFKLRRPPDDGGQD
T
KALVEMNGISLLPKGSRDCGLHGQASKVAPQDLTPTATPSSMANFLYSTSMPNHTIRELKQEVPTCPLT
P
SDLGMGWPVPEPHVPSTQDFSDCC
GQTPAGPAGPLIQNVHASKRILFSIVHDKSEKWDPFIKEMEDINT
L
RECVQILFNSRY
AEALGLDHMVPVPYRKIACDPEAVEIVGIPDKIPFKRPCTYGVPKLKRILEERHSIH
F
IIK
RMFDERIFTGNKFTKDPMKLEPASPPEDTSTEVCRDSMLDLAGTAWSDMSSVSEDCGPGTSGEIAM
L
RPIKIEPEELDIIQVTVS
DPSPTSEEMTDSLPGHLPSEDSGYGMEMPADKGPSEEPWSEERPAEESPGD
V
IRPLRKQVEMLFNTKY
AKAIGTSEPVKVPYSKFLMHPEELFVLGLPEGISLRRPNCFGIAKLRKILEAS
N
SIQFVIK
RPELLTDGVKEPVLDTQERDSWDRLVDETPKRQGLQENYNTRLSRIDIANTLREQVQDLFNK
K
Y
GEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILSVADKIKFTVTRPFQGLI
P
KP
ETKILTTGHEAGKTTRPRRLQQDTWQPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPY
K
LIRDSPDAVEVKGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQL
QPFAEVCNDPKVPEEDDSNK
L
GKKVILREQVKELFNEKY
GEALGLNRPVLVPYKLIRDSPDAVEVKGLPDDIPFRNPNTYDIHRLEKILK
A
REHVRMVIINQL
QPFGDVCNNAKVPAKDNIPKRKRKRVSEGNSVSSSSSSSSSSSNPESVASTNQISLV
Q
WPVYMVDYSGLNVQLPGPLDY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser