NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38917.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38917.1 Public Mus musculus 4 Selenon 21 106 86 CCDS HistoryNCBI Gene:74777Re-query CCDS DB by CCDS ID:38917.1Re-query CCDS DB by GeneID:74777See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)


Attributes
Contains selenocysteine

Sequence IDs included in CCDS 38917.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060435 ENSMUSP00000060026 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060435Link to Ensembl Protein Viewer:ENSMUSP00000060026Re-query CCDS DB by Nucleotide ID:ENSMUST00000060435Re-query CCDS DB by Protein ID:ENSMUSP00000060026
Original member Current member EBI,WTSI OTTMUST00000026309 OTTMUSP00000012033 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000026309Link to Vega Protein Viewer:OTTMUSP00000012033Re-query CCDS DB by Nucleotide ID:OTTMUST00000026309Re-query CCDS DB by Protein ID:OTTMUSP00000012033
Original member Current member NCBI NM_029100.2 NP_083376.2 Accepted alive Link to Nucleotide Sequence:NM_029100.2Link to Protein Sequence:NP_083376.2Re-query CCDS DB by Nucleotide ID:NM_029100Re-query CCDS DB by Protein ID:NP_083376Link to BLAST:NP_083376.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083376.2 557 D3Z2R5 557 100% 0 0

Chromosomal Locations for CCDS 38917.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 134539616 134539789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134540634 134540735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134540823 134540935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134542337 134542442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134542713 134542901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134543050 134543131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134544585 134544722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134545189 134545313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134545481 134545690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134547951 134548084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134551417 134551534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 134551937 134552119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair. This works on the replacement symbol in the Translation Exceptions section also.

Translation Exceptions:
replace the symbol * (codon TGA) with U at amino acid position 428

Nucleotide Sequence (1674 nt):
ATGGGCCAGGCCAGGCCCGCAGCGCGCCGCCCGCACAGCCCGGACCCCGGCGCTCAGCCCGCGCCTCCAC
GC
CGCCGCGCCCGCGCCCTGGCGCTGCTCGGAGCCCTGCTGGCGGCCGCCGCCGCTGTCGCCGCTGCCCG
G
GCCTGCGCGCTCCTCGCCGACGCCCAGGCGGCCGCGCGGCAGGAATCGGCATTAAAGGTCCTGGGGACA
GAT
GGCCTCTTTCTCTTTTCCTCGCTGGACACTGACCAGGATATGTACATCAGTCCGGAGGAATTCAAAC
CC
ATTGCGGAGAAACTGACAGGGTCAGTTCCTGTGGCCAACTACGAGGAGGAGGAACTGCCCCATGACCC
C
AGCGAGGAGACTCTTACCATAGAAGCCCGATTCCAGCCTCTGCTCATGGAGACCATGACCAAAAGCAAA
GAT
GGCTTCCTAGGGGTCTCCCGCCTCGCTCTGTCCGGCCTCCGCAACTGGACCACAGCAGCCTCGCCGA
GT
GCAGCGTTTGCTGCCCGCCACTTCCGGCCCTTCCTGCCCCCTCCAGGTCAGGAGCTGGGCCAGCCCTG
G
TGGATTATCCCCGGGGAGCTGAGCGTCTTCACGGGCTATTTGTCCAACAACCGCTTCTACCCACCACCG
CCC
AAGGGCAAGGAGGTCATCATCCATCGCCTGTTAAGCATGTTCCATCCACGCCCCTTCGTGAAGACCC
GC
TTTGCCCCTCAGGGCACCGTGGCCTGTCTGACTGCCATCAGCGATTCCTACTACACCGTGATGTTCCG
G
ATCCACGCGGAGTTTCAGCTCAGCGAGCCTCCTGACTTCCCCTTCTGGTTCTCGCCCGGCCAGTTCACC
GGC
CATATCATCTTATCCAAAGATGCTACACACATCCGTGACTTCAGGCTGTTTGTGCCCAATCACAGGT
CC
CTGAATGTGGACATGGAGTGGCTGTATGGGGCCAGTGAGACCAGCAACATGGAGGTGGACATTGGCTA
C
GTCCCCCAGATGGAGCTGGAGGCTGTGGGCCCCTCGGTGCCCTCTGTGATCCTAGATGAGGACGGCAAC
ATG
ATTGACAGCCGCCTGCCCTCAGGAGAACCCCTCCAGTTTGTGTTTGAGGAGATCAAGTGGCATCAGG
AG
CTGAGCTGGGAAGAGGCTGCCCGGCGCCTGGAGGTGGCCATGTATCCCTTCAAGAAGGTCAACTACCT
G
CCGTTCACGGAGGCCTTTGACAGAGCCAGAGCTGAGAAGAAACTTGTTCATTCCATCTTGCTGTGGGGG
GCC
CTGGACGACCAGTCCTGCTGAGGTTCCGGGCGGACTCTCCGGGAGACTGTCCTGGAAAGCCCGCCCA
TC
CTCACTCTCCTCAATGAGAGCTTCATCAGTACCTGGTCCCTGGTAAAGGAGCTAGAAGACCTGCAGAC
C
CAGCAGGAGAACCCACTCCACAGGCAGCTGGCAGGCCTGCACTTGGAGAAGTACAGCTTTCCTGTAGAG
ATG
ATGATCTGTCTGCCCAACGGCACTGTGGTCCACCACATCAATGCCAACTACTTCCTTGACATCACCT
CC
ATGAAGCCTGAAGACATGGAGAATAATAACGTCTTCAGCTTCTCATCCAGCTTTGAGGACCCGTCCAC
A
GCTACCTACATGCAGTTCCTGAGGGAAGGACTCCGGCGGGGCCTGCCCCTCCTCCAGCCCTAG


Translation (557 aa):
MGQARPAARRPHSPDPGAQPAPPRRRARALALLGALLAAAAAVAAARACALLADAQAAARQESALKVLGT
D
GLFLFSSLDTDQDMYISPEEFKPIAEKLT
GSVPVANYEEEELPHDPSEETLTIEARFQPLLMETMTKSK
D
GFLG
VSRLALSGLRNWTTAASPSAAFAARHFRPFLPPPGQELGQPWWIIPGELSVFTGYLSNNRFYPPP
P
KGKE
VIIHRLLSMFHPRPFVKTRFAPQGTVACLTAISDSYYTVMFRIHAEFQLSEPPDFPFWFSPGQFT
G
HIILSKDATHIRDFRLFVPNH
RSLNVDMEWLYGASETSNMEVDIGYVPQMELEAVGPSVPSVILDEDGN
M
IDSRLPSGEPLQFVFEEIKWHQELSWEEAARRLEVAMYPFKK
VNYLPFTEAFDRARAEKKLVHSILLWG
A
LDDQSCU
GSGRTLRETVLESPPILTLLNESFISTWSLVKELEDLQTQQENPLHRQLAGLHLEKYSFPVE
M
MICLPNGTV
VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRRGLPLLQP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser