NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38882.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38882.1 Public Mus musculus 4 Tmem35b 21 106 86 CCDS HistoryNCBI Gene:100039968Re-query CCDS DB by CCDS ID:38882.1Re-query CCDS DB by GeneID:100039968See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38882.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094712 ENSMUSP00000092302 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094712Link to Ensembl Protein Viewer:ENSMUSP00000092302Re-query CCDS DB by Nucleotide ID:ENSMUST00000094712Re-query CCDS DB by Protein ID:ENSMUSP00000092302
Original member Current member EBI,WTSI OTTMUST00000021214 OTTMUSP00000009705 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000021214Link to Vega Protein Viewer:OTTMUSP00000009705Re-query CCDS DB by Nucleotide ID:OTTMUST00000021214Re-query CCDS DB by Protein ID:OTTMUSP00000009705
Original member Current member NCBI NM_001099319.2 NP_001092789.1 Accepted alive Link to Nucleotide Sequence:NM_001099319.2Link to Protein Sequence:NP_001092789.1Re-query CCDS DB by Nucleotide ID:NM_001099319Re-query CCDS DB by Protein ID:NP_001092789Link to BLAST:NP_001092789.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001092789.1 150 Q3U0Y2 150 100% 0 0

Chromosomal Locations for CCDS 38882.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 127126089 127126193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127127819 127127999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 127128854 127129020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (453 nt):
ATGTCGTTCAGGGTAGGCGTGTTGCGGGTTCTGCTTGGCGTCTTCTTCGCGCTCACCGGGGCTGCCAAGC
TC
TTTCAGGTCTCGGCCCCCGTGTCACAACAGATGAGAGCCTTGTTCGAGCAGTTTGCTGAGGTGTTTCC
A
TTGAAGGTGTTCGGCTACCAGCCAGACCCTATAAGCTACCAGACAGCTGTGGGATGGCTGGAACTGCTG
GCT
GGGTTGCTGCTGGTCGTGGGTCCACCTGTGCTACAGGAGATCAGTAACGTGCTCTTGATCCTACTCA
TG
ATGGGGGCTGTCTTCACTCTGGTGGTTCTGAAAGAGCCACTGAGTACTTACGTCCCAGCTGCTGTCTG
T
CTGGGGCTCCTGCTGCTGCTGGATTCCTGCCACTTCTTAGCTCGTACTAAGGGAGCGGTCAGATGCCCG
AGC
AAGAAGATTCCTCCTGCACACGGCAATTGA


Translation (150 aa):
MSFRVGVLRVLLGVFFALTGAAKLFQVSAPVSQQMRALFEQFAEVFPLKVFGYQPDPISYQTAVGWLELL
A
GLLLVVGPPVLQEISNVLLILLMM
GAVFTLVVLKEPLSTYVPAAVCLGLLLLLDSCHFLARTKGAVRCP
S
KKIPPAHGN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser