NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38711.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38711.1 Public Mus musculus 4 Aptx 21 106 86 CCDS HistoryNCBI Gene:66408Re-query CCDS DB by CCDS ID:38711.1Re-query CCDS DB by GeneID:66408See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38711.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000068125 ENSMUSP00000124264 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000068125Link to Ensembl Protein Viewer:ENSMUSP00000124264Re-query CCDS DB by Nucleotide ID:ENSMUST00000068125Re-query CCDS DB by Protein ID:ENSMUSP00000124264
Original member Current member EBI,WTSI OTTMUST00000014996 OTTMUSP00000006929 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014996Link to Vega Protein Viewer:OTTMUSP00000006929Re-query CCDS DB by Nucleotide ID:OTTMUST00000014996Re-query CCDS DB by Protein ID:OTTMUSP00000006929
Original member Current member NCBI NM_025545.4 NP_079821.3 Accepted alive Link to Nucleotide Sequence:NM_025545.4Link to Protein Sequence:NP_079821.3Re-query CCDS DB by Nucleotide ID:NM_025545Re-query CCDS DB by Protein ID:NP_079821Link to BLink:NP_079821.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079821.3 342 Q7TQC5-1 342 100% 0 0

Chromosomal Locations for CCDS 38711.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 40686559 40686713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40688109 40688212 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40690969 40691195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40693390 40693449 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40694852 40695136 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40695377 40695423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40697217 40697353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 40702724 40702737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1029 nt):
ATGCCGGAAGCAGTAGCTAAGATGCGAGTGTGCTGGTTGGTGAGACAGGACAGCAGGCACCAGCGAATCA
AA
CTTCCCCATTTGGAAGCTGTTGTGATTGGTCGAAGCCCAGAGACCAAGATCACAGATAAGAAATGTTC
C
CGACAGCAAGTACAGTTGAAAGCAGAGTGTAACAAGGGATATGTCAAAGTACAGCAGATGGGGGTCAAC
CCC
ACCAGCATTGACTCGGGCGTCATCGGGAAGGACCAAGAGAAGAAGCTGCTGCCTGGTCAGGTTCTCC
AC
ATGGTGAATGGACTTTATCCATACATCGTAGAGTTTGAGGAAGTGGCAGAGAGCCCTAACCTAACACA
G
AGGAAGAGAAAGAGGTCAGACTGTGATAGTGAGGAGATGGAAGCTGAGTCTGGGACAGGGCTGGCACCT
GGG
AGCAGCCCCAGCCAGTGCTCTGTGTCCCCTAAGAAGGACAAGAATGGAGCCACCAAAAAGGAATCAC
TG
GGCCACTGGAGTCAAGGCTTGAAGATGTCTATGAAAGACCCCAAAATGCAGGTTTACAAAGACGACCA
G
GTGGTGGTGATTAAGGATAAATACCCCAAGGCCCGTCACCACTGGCTGGTCTTACCGTGGGCCTCCATT
TCC
AGTCTGAAGGTTGTGACCAGTGAACACCTTGAACTTCTCAAACATATGCACGCTGTGGGGGAGAAGG
TG
ATAGCAGATTTTGCTGGATCCAGCAAACTGCGCTTCCGATTGGGCTACCATGCCATTCCCAGCATGAG
C
CACGTACATCTTCATGTGATCAGCCAGGATTTTGATTCTCCTTGCCTTAAAAACAAAAAGCATTGGAAT
TCT
TTTAATACAGAATACTTTCTGGAATCACAAGCTGTGATCAAGATGGTTCAGGAAGCCGGCAGAGTGA
CT
GTTAAAGATGGCACTTGTGAGCTCTTGAAGCTGCCTCTCCGTTGCCATGAGTGTCAGCAGCTGCTGCC
T
TCCATCCCGCAGCTGAAAGAGCACCTCAGGAAGCACTGGGGCGGGTGA


Translation (342 aa):
MPEAVAKMRVCWLVRQDSRHQRIKLPHLEAVVIGRSPETKITDKKCSRQQVQLKAECNKGYVKVQQMGVN
P
TSIDSGVIGKDQEKKLLPGQVLHMVNGLYPYIVEFEEVAESPNLTQRKRKRSDCDSEEMEAESGTGLAP
G
SSPSQCSVSPKKDKNGATKK
ESLGHWSQGLKMSMKDPKMQVYKDDQVVVIKDKYPKARHHWLVLPWASI
S
SLKVVTSEHLELLKHMHAVGEKVIADFAGSSKLRFRLGYHAIPSM
SHVHLHVISQDFDSPCLKNKKHWN
S
FNTEYFLESQ
AVIKMVQEAGRVTVKDGTCELLKLPLRCHECQQLLPSIPQLKEHLRKHWGG



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser