NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38689.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38689.1 Public Mus musculus 4 Chd7 21 106 86 CCDS HistoryNCBI Gene:320790Re-query CCDS DB by CCDS ID:38689.1Re-query CCDS DB by GeneID:320790See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 38689.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039267 ENSMUSP00000043903 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039267Link to Ensembl Protein Viewer:ENSMUSP00000043903Re-query CCDS DB by Nucleotide ID:ENSMUST00000039267Re-query CCDS DB by Protein ID:ENSMUSP00000043903
Original member Current member EBI,WTSI ENSMUST00000051558 ENSMUSP00000059079 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051558Link to Ensembl Protein Viewer:ENSMUSP00000059079Re-query CCDS DB by Nucleotide ID:ENSMUST00000051558Re-query CCDS DB by Protein ID:ENSMUSP00000059079
Original member Current member EBI,WTSI OTTMUST00000010005 OTTMUSP00000004792 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010005Link to Vega Protein Viewer:OTTMUSP00000004792Re-query CCDS DB by Nucleotide ID:OTTMUST00000010005Re-query CCDS DB by Protein ID:OTTMUSP00000004792
Original member Current member NCBI NM_001277149.1 NP_001264078.1 Accepted alive Link to Nucleotide Sequence:NM_001277149.1Link to Protein Sequence:NP_001264078.1Re-query CCDS DB by Nucleotide ID:NM_001277149Re-query CCDS DB by Protein ID:NP_001264078Link to BLAST:NP_001264078.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001264078.1 2986 A2AJK6-1 2986 100% 0 0

Chromosomal Locations for CCDS 38689.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 8751505 8753148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8785342 8785763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8801324 8801465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8805151 8805288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8806296 8806361 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8811440 8811495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8822377 8822491 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8825462 8825545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8826209 8826346 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8826443 8826564 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8826884 8827127 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8828232 8828408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8832475 8832618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8833740 8833995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8838551 8838761 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8839425 8839620 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8840389 8840556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8841096 8841275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8844312 8844422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8844507 8844712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8847079 8847278 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8847457 8847616 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8850796 8850885 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8851254 8851357 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8852678 8852807 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8853174 8853246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8853403 8853460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8854065 8854293 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8854525 8854733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8854846 8855514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8856671 8856831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8858479 8858706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8859043 8859486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8862490 8862711 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8863909 8864049 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8864201 8864305 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 8865738 8866655 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8961 nt):
ATGGCGGACCCAGGGATGATGAGTCTTTTTGGCGAGGATGGGAGTCTGTTCAGCGAAGGCCTCGAAGGCC
TC
GGGGAATGTGGCTACCCCGAAAACCCCGTGAACCCCATGGGTCAGCAGATGCCCATAGACCAAGGTTT
T
CCCTCCTTACAGCCATCCCTCCACCATCCTTCACCTAATCAGAATCAAACCAAGTTGACCCATTTTGAT
CAC
TATAGTCAGTATGAACAGAAGATGCATCTGATGGATCAGCCTAACCGAATGATGGGCAGCGCCCCCG
GG
AACGGATTGGCGTCTCCGCACTCACAGTATCACACCCCTCCCGTCCCCCAGGTGCCCCACGGAGGCGG
T
GGTGGCGGTCAGATGGGAGTCTATCCCGGCATCCAGAACGAAAGGCACGGGCAATCTTTTGTGGATGGC
GGC
TCCATGTGGGGCCCCCGGGCCGTTCAGGTACCAGACCAGATACGAGCCCCCTACCAGCAGCAGCAGC
CG
CAGCCGGCTCCTTCGGGGCCCCCGGCACAGGGCCACCCCCAGCACATGCAGCAGATGGGCAGCTATCT
G
GCACGTGGGGATTTCTCCATGCAGCAGCACGGCCAGCCACAGCAGAGGATGGGCCAGTTTTCCCAAGGC
CAA
GAGGGCCTCAGTCAGGGAAGCCCTTTCATTGCCACCTCAGGACCCGGCCACCTGTCGCACATGCCCC
AG
CAGAGCCCCAGCATGGCCCCTTCCCTGCGCCACCCAGTGCAGCAGCAGTTCCACCATCACCCCGCTGC
T
CTCCACGGAGAATCCGTTGCCCACAGTCCCAGATTCTCCCCCAACCCTCCTCAACAAGGGGCTGTCAGG
CCA
CAAACCCTTAACTTTAGTTCTCGGAACCAGACAGTCCCCTCCCCTACTGTAAACAACTCAGGGCAGT
AT
TCTCGATATCCTTACAGTAACCTAAATCAGGGATTAGTTAACAGTACAGGGATGAATCAAAATTTAGG
C
CTTACAAACAGTACTCCAATGAATCAGTCGGTACCAAGATACCCCAATGCCGTGGGATTCCCGTCAAAC
AGT
GGTCAGGGACTCGTGCACCAGCAGCCTATCCACTCCAGTGGCTCACTGAACCAAATGAACACACAAA
CT
ATGCACCCTTCACAGCCTCAGGGAACGTACGCCTCTCCACCTCCCATGTCACCCATGAAAGCAATGAG
T
AACCCAGCAGGCACGCCGCCTCCGCAGGTCAGGCCCGGAAGTGCTGGGATGCCCATGGAAGTTGGCAGT
TAT
CCAAATATGCCCCACCCTCAGCCATCTCACCAGCCCCCTGGTGCCATGGGAATCGGACAGAGGAATA
TG
GGCCCCAGAAACATGCAGCAGCCTCGTTCGTTTATGGGCATGTCCTCGGCACCCAGGGAGCTGACCGG
A
CACATGAGACCAAATGGTTGCCCTGGTGTCGGCCTTGCGGATCCACAAGCAATCCAGGAACGACTGATA
CCT
GGCCAACAGCACCCTGGTCAGCAGCCATCTTTCCAGCAGTTGCCAACCTGTCCTCCACTACAGCCCC
AC
CCAGGCCTGCACCAGTCTTCACCTCCACATCCCCATCACCAGCCTTGGGCACAACTCCACCCGTCACC
C
CAGAATACCCCACAGAAAGTGCCTGTGCATCAGCATTCTCCATCGGAGCCCTTTCTAGAGAAGCCAGTG
CCG
GATATGACCCAGGTCAGCGCACAGAACGCTCAGCTAGTGAAGAGCGACGATTACCTGCCGTCGATAG
AG
CAGCAGCCACAGCAGAAGAAGAAGAAAAAGAAAAACAACCACATTGCTGCAGGGGATTCCAGTAAAGG
T
TTTGGTAAAGATGACTTCCCTGGTGGGGTTGAAAACCAAGAACTGCGCAGGAACTCACTGGATGTGTCC
CAG
GAAGAAAAAAAGAAAAAGAAAAGGCCGAAGGTCAAAAAAGATCCGAAGGAATCGAAGGAGCCGAAGG
AG
AAGAAAGAGCCCAAGACCCCAAAAGCCCCGAAGATCCCCAAAGAGCCAAAGGAAAAGAAAGCAAAAAC
T
GTCACGCCAAAACCCAAATCCAGCAAAAAGTCAAGTAATAAGAAACCGGATTCAGAAGCAAGTGCTTTG
AAG
AAGAAGGTCAACAAAGGAAAAACAGAAGGTTCTGAAAATTCAGACTTGGACAAAACACCCCCACCGT
CC
CCCGCTCCTGAAGAGGACGAAGACCCAGGTGTCCAGAAGAGGCGGTCCAGCAGGCAGGTGAAGAGGAA
G
CGATACACTGAAGATTTGGAGTTCAAGATTTCTGATGAGGAGGCAGATGATGCAGATGCTGCTGGAAGA
GAC
TCCCCATCCAACACCTCGCAGTCAGAGCAGCAGGAATCTGTTGATGCAGAAGGCCCAGTGGTGGAGA
AG
ATTATGAGCAGCCGCCTAGTGAAAAAGCAGAAGGAATCTGGCGAGGAGGTAGAAGTTGAGGAATTTTA
T
GTGAAGTACAAAAACTTCTCCTATCTTCATTGTCAGTGGGCGTCAGTAGAAGATCTGGAAAAAGACAAG
AGA
ATTCAGCAAAAGATAAAACGGTTTAAGTCAAAACAGGGCCAGAGCAAATTCCTCTCAGAGATTGAGG
AT
GACCTTTTTAATCCAGACTATGTGGAAGTTGACCGGATAATGGACTTTGCACGTAGCACAGATGACCG
G
GGCGAGCCTGTGATTCACTACCTGGTGAAGTGGTGCTCACTCCCTTATGAAGACAGCACATGGGAGCTG
AAG
CAGGACATAGATCAAACAAAGATCGAAGAGTTTGAAAAACTCATGTCCAGGGAGCCGGAAACCGAGC
GT
GTGGAGCGACCTCCTGCTGATGACTGGAAGAAATCGGAGAGTTCCAGGGAGTATAAAAACAATAACAA
A
CTCAGGGAATACCAGTTGGAGGGAGTAAACTGGCTACTTTTCAATTGGTACAACATGCGAAACTGCATT
TTA
GCAGATGAGATGGGTTTGGGAAAAACGATCCAGTCCATTACGTTTCTCTATGAGATATACTTGAAAG
GA
ATCCATGGCCCCTTTTTAGTAATTGCCCCATTGTCCACGATCCCCAACTGGGAAAGGGAATTCCGAAC
C
TGGACGGAGTTGAACGTGGTTGTGTACCATGGGAGCCAAGCCAGCCGTCGGACCATTCAGTTGTATGAA
ATG
TACTTCAAAGATCCCCAGGGTCGAGTGATAAAGGGGTCCTATAAGTTCCACGCCATCATCACTACAT
TC
GAGATGATTCTGACGGACTGTCCTGAGCTGCGTAATATTCCTTGGCGCTGTGTGGTCATCGATGAAGC
C
CACAGGCTGAAGAACAGAAACTGCAAGCTGCTGGAAGGGCTGAAGATGATGGACTTGGAACACAAAGTC
CTG
CTGACCGGGACCCCGCTGCAGAACACTGTGGAAGAGCTCTTCAGCCTGCTTCATTTCTTGGAGCCAA
GT
CGCTTCCCTTCAGAAACAACCTTTATGCAAGAATTTGGTGATCTGAAAACGGAAGAGCAGGTGCAAAA
A
CTACAGGCTATTCTAAAGCCAATGATGTTGAGACGCCTGAAAGAGGATGTAGAAAAGAACTTGGCCCCC
AAA
GAAGAGACTATTATTGAAGTTGAGCTAACAAACATTCAGAAGAAATATTACCGAGCCATCCTTGAGA
AG
AATTTTACATTTCTTTCCAAAGGTGGTGGACAAGCTAACGTACCTAACCTTTTAAACACTATGATGGA
A
CTGAGAAAATGCTGCAATCATCCCTACCTAATCAATGGTGCTGAAGAGAAAATTTTGGAAGAGTTTAAA
GAA
ACACACAATGCAGAGTCTCCAGATTTTCAGCTCCAGGCAATGATCCAGGCTGCTGGCAAGCTGGTGC
TG
ATTGACAAGCTGCTGCCAAAGCTGAAGGCTGGTGGCCACAGGGTGCTTATCTTCTCCCAGATGGTGCG
C
TGCTTGGACATCCTGGAAGACTATCTCATCCAGAGACGGTACCCATACGAAAGGATTGATGGCCGGGTC
AGA
GGCAACCTCCGCCAGGCAGCTATTGACAGATTCTCCAAACCTGATTCTGATAGGTTTGTGTTCCTCC
TG
TGCACACGGGCAGGAGGGCTAGGCATTAACCTCACTGCTGCTGATACCTGCATCATCTTTGATTCAGA
C
TGGAATCCCCAGAATGACCTCCAGGCTCAAGCTAGATGCCACAGAATAGGGCAGAGCAAATCTGTGAAA
ATC
TACAGGCTGATTACAAGGAACTCCTATGAAAGGGAGATGTTTGACAAGGCTAGTCTGAAGCTGGGTC
TG
GATAAAGCCGTGTTGCAGTCCATGAGTGGAAGAGAAAATGCCACTAACGGGGTACAACAGCTGTCCAA
G
AAGGAAATAGAAGACCTCCTGCGAAAGGGGGCATATGGTGCACTTATGGATGAAGAAGATGAAGGGTCT
AAG
TTTTGTGAAGAGGATATTGACCAGATTCTCCTTCGACGAACCCACACTATCACCATTGAGTCTGAAG
GA
AAAGGCTCCACATTTGCTAAGGCCAGCTTTGTTGCGTCTGGAAATAGGACAGACATTTCTTTGGATGA
C
CCAAATTTCTGGCAGAAGTGGGCTAAGAAGGCTGAATTGGACATCGATGCCTTAAACGGGAGGAACAAC
CTG
GTTATTGACACTCCTCGAGTGAGGAAGCAGACCCGGCTATACAGCGCAGTGAAGGAAGACGAACTGA
TG
GAGTTCTCCGACCTGGAAAGCGACTCCGAAGAAAAGCCTTGTGCAAAGCCACGGCGCCCCCAGGATAA
G
TCTCAGGGCTATGCCCGGAGCGAGTGCTTCAGGGTAGAGAAGAATCTGCTGGTTTACGGCTGGGGCCGC
TGG
ACAGATATCCTGTCCCATGGACGCTACAAACGTCAGCTGACTGAGCAAGATGTCGAAACCATCTGCA
GA
GCGATCCTGGTGTACTGTCTCAACCACTACAGAGGGGACGAGAACATCAAAAGCTTTATCTGGGACCT
C
ATCACACCCACGGCGGATGGCCAGACTCGGGCCCTGCTAAATCATTCCGGTCTGTCGGCCCCTGTGCCG
AGG
GGCCGGAAGGGGAAGAAGGTGAAGGCCCAGAGTACGCAGCCAGTAGTGCACGATGCTCACTGGCTGG
CA
AGCTGCAACCCAGACGCCCTGTTCCAGGAGGACAGCTACAAGAAGCACCTGAAGCACCACTGCAACAA
G
GTCCTGCTGCGTGTCCGCATGCTGTACTACCTAAGACAAGAAGTGATAGGAGACCAGGCAGAGAAGATC
CTC
GAGGGCGCTGACTCAAGTGAAGCAGACGTGTGGATCCCTGAGCCATTCCATGCTGAGGTTCCTACAG
AT
TGGTGGGACCGAGAAGCAGACAAATCCCTCCTAATTGGAGTGTTTAAACATGGCTATGAGAAGTACAA
T
TCCATGCGAGCTGACCCTGCACTGTGCTTCCTGGAACGAGTCGGAATGCCCGATGCCAAGGCCATCGCT
GCC
GAGCAGAGAGGGACAGACATGCTAGCAGATGGTGGTGACGGTGGAGAATTTGATAGAGAAGATGAAG
AT
CCTGAATATAAACCAACGAGAGCACCATTCAAAGATGAAATAGATGAATTTGCGAATTCTCCCGCAGA
G
GATAAGGAAGAGTCCATGGAGGTGCACAGCTCAGGCAAGCACAGCGAGAGCAATGCTGAGTTAGGTCAG
CTC
TACTGGCCGAACACGTCAACCCTGACTACGCGTCTGCGCCGGCTCATTACTGCCTATCAGCGCAGCT
AT
AAAAGGCAGCAAATGAGGCAAGAGGCCCTAATGAAGACGGACCGGCGCAGACGGAGGCCCCGGGAGGA
A
GTGAGAGCGCTGGAGGCAGAAAGGGAAGCTATTATATCTGAGAAAAGGCAAAAGTGGACGAGAAGAGAA
GAA
GCGGACTTTTACCGGGTGGTATCCACCTTCGGGGTTATTTTTGACCCAGTGAAACAGCAGTTTGATT
GG
AACCAATTCCGAGCCTTTGCCAGACTAGACAAAAAGTCTGATGAGAGCCTGGGGAAGTATTTCAGCTG
C
TTTGTGGCCATGTGCAGACGGGTGTGTCGGATGCCTGCCAAGCCCGAGGACGAGCCACCTGACCTCGCC
TCC
CTTATCGAGCCCATCACGGAGGAACGAGCATCCAGGACACTGTACCGCATTGAACTGCTTCGCAAGA
TC
CGAGAGCAGGTCCTTCATCACCCACAACTAAGTGACAGGCTGAAGCTCTGCCAGCCCAGCCTAGATCT
G
CCCGAGTGGTGGGAATGTGGACGGCACGACAGGGACCTGCTGGTGGGTGCTGCTAAGCACGGGGTCAGC
CGG
ACAGACTATCACATCCTCAACGACCCTGAGTTGTCCTTCTTAGATGCACACAAAAGCTTTGCTCAGA
AC
CGTGGGGCCAGTACCGTCCCTCCTTTGAATACTCTGGCCATGGGCTTTGGCCAGACTCCTCCAGTCAT
T
TCCTCTGCTCACGTTCACGAAGAAAAGGCAATGGAGCAGGCTGAAGGCAAGGCAGAGGAGTGTGAACAC
TCA
CCGGCCAAAGAGAGGTCGGATGGGAAAGAGGAGGAAGAAGAAGCAGGCGGGGCCAAGGATGGCAAGC
AG
GAATGTGAGGTCGAGGCCAGCTCTGTGAAGGGTGAACTCAAAGGGGTGGAGGGCAGTGCAGACCCTGG
G
TCCAAGTCTGTCTCAGAGAAGGGCTCAGAAGAGGACGAAGAAGAGAAGCTGGAGGACGATGATAAGTCG
GAG
GAGTCGTCGCAGCCAGAAGCAGGAGCCGTCTCGAGAGGGAAGACTTTCGATGAAGAAAGCAATGCTT
CT
CTGAGCACTGCTAGGGATGAAACCCGAGATGGATTCTACATGGAGGATGGAGATGCTTCGGTGGCTCA
G
CTCCTTCATGAACGAACATTTGCCTTCTCCTTTTGGCCCAAGGACAGAGTAATGATAAACCGATTAGAC
AAC
ATCTGTGAAGCTGTGTTGAAAGGCAAATGGCCAGTAAATCGGCGCCAGATGTTTGATTTCCAGGGCC
TT
GTCCCTGGGTACCCACCCTCCGCCGTGGACAGTCCCCTGCAGAAGAGGAGCTTTGCCGAGCTCTCTAT
G
GTCAGCCAGGCCAGCATCAGTGCGAGCGAGGACATCACCACGTCTCCTCAGTTGTCCAAGGATGATGCC
CTC
AACCTGTCTGTCCCTCGCCAGCGGCGGCGGAGGAGAAGGAAAGTTGAAATCGAGGCTGAAAGAGCTG
CC
AAGAGGAGAAACCTTATGGAGATGGTTGCCCAGCTTCGAGAGTCTCAGGTGGTCTCAGAAAATGGACA
A
GAAAAAGTTGTGGACTTATCAAAGGCCTCGAGAGAGGCAACAAGCTCTACCTCAAATTTCTCATCTCTT
ACT
TCAAAGTTTATCTTGCCTAATGTCTCCACGCCAGTGTCTGATGCCTTTAAGTCTCAGATGGAGCTGC
TC
CAAGCAGGCCTTTCACGCACACCCACAAGGCATATGCTCAATGGCTCCCTGGTGGATGGAGAGCCCCC
C
ATGAAGAGGAGGCGAGGCAGGAGGAAAAACGTGGAGGGCCTCGACCTACTTTTCATGAGCCACAAACGG
ACG
CCGTTAAGTGCAGAGGATGCTGAGGTGACCAAAGCTTTTGAAGAAGATATAGAGACCCCACCAATAA
GA
AACATTCCTTCTCCTGGACAGCTGGACCCCGACACCCGGATCCCTGTGATAAACCTTGAAGATGGGAC
T
AGGCTGGTGGGAGAAGACGCTCCTAAAAACAAGGACTTGGTTGACTGGCTGAAGCTGCACCCCACCTAC
ACT
GTCGATATGCCGAGTTATGTACCAAAGAACACAGACGTGCTGTTTTCCTCGTTTCAGAAACCGAAAC
AG
AAACGACATAGATGTCGAAATCCTAATAAATTGGATATTAACACTTTGACAGGAGAAGAAAGGGTTCC
T
GTTGTTAACAAACGAAATGGGAAGAAGATGGGTGGAGCCATGGCCCCTCCAATGAAGGACCTGCCCAGG
TGG
CTGGAGGAGAACCCTGAGTTTGCTGTCGCTCCAGACTGGACCGATATAGTCAAGCAGTCTGGTTTTG
TT
CCCGAGTCAATGTTTGACCGTCTCCTCACTGGACCTGTGGTGCGGGGAGAAGGAGCCAGCAGGAGAGG
A
CGGAGGCCCAAGAGCGAGATCGCCCGAGCAGCCGCGGCGGCTGCTGCTGTCGCCTCTACTTCAGGGATC
AAC
CCTCTGTTGGTGAACAGCCTGTTTGCTGGGATGGACCTGACAAGCCTTCAGAATCTCCAGAACCTCC
AG
TCCCTCCAGCTGGCAGGGCTCATGGGCTTCCCTCCAGGACTGGCCACAGCTGCCACCGCCGGAGGCGA
T
GCGAAGAGCCCCGCCGCAGTGCTGCCCCTGATGCTGCCAGGGATGGCGGGCCTGCCCAACGTGTTCGGC
TTG
GGCGGGCTGCTGAACAACCCTCTCTCAGCTGCTACTGGAAACACCACTACTGCTTCAAGTCAAGGAG
AG
CCAGAGGATGGCACTTCCAAAGCGGAAGAGAAAGGAAACGACAATGAAGACGAGAACCGAGACTCTGA
G
AAAAGCACAGACACCGTTTCGGCTGCTGACTCCGCGAACGGATCTGTTGGTGCTGCTACTGCCCCGGCT
GCG
TTACCCTCCAACCCGCTGGCCTTCAACCCTTTCCTCCTGTCCACCATGGCCCCAGGCCTCTTCTACC
CA
TCCATGTTTCTACCTCCAGGACTGGGGGGATTGACACTGCCTGGCTTCCCAGCACTGGCGGGACTCCA
A
AACGCCGTGGGTACCAGCGAAGAAAAGGCTGCTGACAAGGCCGAGGGAGGGCCCTGTAAAGACGGAGAG
ACC
CTGGAGGGCAGCGATGCCGAGGAGAACCTGGACAAGACTGTAGAGTCCTCCATCTTGGAAGACGAGG
TT
GCACAGGGTGAAGAGCTGGACTCCCTCGAAGGCGGGGATGAGATAGAAAACACCGGAAACGACGAGTA
A


Translation (2986 aa):
MADPGMMSLFGEDGSLFSEGLEGLGECGYPENPVNPMGQQMPIDQGFPSLQPSLHHPSPNQNQTKLTHFD
H
YSQYEQKMHLMDQPNRMMGSAPGNGLASPHSQYHTPPVPQVPHGGGGGGQMGVYPGIQNERHGQSFVDG
G
SMWGPRAVQVPDQIRAPYQQQQPQPAPSGPPAQGHPQHMQQMGSYLARGDFSMQQHGQPQQRMGQFSQG
Q
EGLSQGSPFIATSGPGHLSHMPQQSPSMAPSLRHPVQQQFHHHPAALHGESVAHSPRFSPNPPQQGAVR
P
QTLNFSSRNQTVPSPTVNNSGQYSRYPYSNLNQGLVNSTGMNQNLGLTNSTPMNQSVPRYPNAVGFPSN
S
GQGLVHQQPIHSSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGSAGMPMEVGS
Y
PNMPHPQPSHQPPGAMGIGQRNMGPRNMQQPRSFMGMSSAPRELTGHMRPNGCPGVGLADPQAIQERLI
P
GQQHPGQQPSFQQLPTCPPLQPHPGLHQSSPPHPHHQPWAQLHPSPQNTPQKVPVHQ
HSPSEPFLEKPV
P
DMTQVSAQNAQLVKSDDYLPSIEQQPQQKKKKKKNNHIAAGDSSKGFGKDDFPGGVENQELRRNSLDVS
Q
EEKKKKKRPKVKKDPKESKEPKEKKEPKTPKAPKIPKEPKEKKAKTVTPKPKSSKKS
SNKKPDSEASAL
K
KKVNKGKTEGSENSDLDKTPPPSPAPEEDEDPGVQ
KRRSSRQVKRKRYTEDLEFKISDEEADDADAAGR
D
SPSNTSQSEQQ
ESVDAEGPVVEKIMSSRLVKKQKESGEEVEVEEFYVKYKNFSYLHCQWASVEDLEKDK
R
IQQKIKRFKSKQGQSKFLSE
IEDDLFNPDYVEVDRIMDFARSTDDRGEPVIHYLVKWCSLPYEDSTWEL
K
QDIDQTKIEEFEKLMSREPETERV
ERPPADDWKKSESSREYKNNNKLREYQLEGVNWLLFNWYNMRNCI
L
ADEMGLGKTIQSITFLYEIYLKGIHGPFLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQLYE
M
YFKDPQ
GRVIKGSYKFHAIITTFEMILTDCPELRNIPWRCVVIDEAHRLKNRNCKLLEGLKMMDLEHKV
L
LTGTPLQNTVEELFSLLHFLEPSRFPSETTFMQEFGDLKTEEQ
VQKLQAILKPMMLRRLKEDVEKNLAP
K
EETIIEVELTNIQKKYYRAILEKNFTFLSKGGGQANVPNLLNTMMELRKCCNHPYLIN
GAEEKILEEFK
E
THNAESPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCLDILEDYLIQR
RYPYERIDGRV
R
GNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQ
AQARCHRIGQSKSVK
I
YRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENATNG
VQQLSKKEIEDLLRKGAYGALMDEEDEGS
K
FCEEDIDQILLRRTHTITIESEGKGSTFAK
ASFVASGNRTDISLDDPNFWQKWAKKAELDIDALNGRNN
L
VIDTPRVRKQTRLYSAVKEDELMEFSDLESDSEEKPCAKPRRPQDKSQGYARSECFRVEKNLLVY
GWGR
W
TDILSHGRYKRQLTEQDVETICRAILVYCLNHYRGDENIKSFIWDLITPTADGQTRALLNHS
GLSAPVP
R
GRKGKKVKAQSTQPVVHDAHWLASCNPDALFQEDSYKKHLKHHCN
KVLLRVRMLYYLRQEVIGDQAEKI
L
EGADS
SEADVWIPEPFHAEVPTDWWDREADKSLLIGVFKHGYEKYNSMRADPALCFLERVGMPDAKAIA
A
EQRGTDMLADGGD
GGEFDREDEDPEYKPTRAPFKDEIDEFANSPAEDKEESMEVHSSGKHSESNAELGQ
L
YWPNTSTLTTRLRRLITAYQRSYKRQQMRQEALMKTDRRRRRPREEVRALEAEREAIISEKRQ
KWTRRE
E
ADFYRVVSTFGVIFDPVKQQFDWNQFRAFARLDKKSDESLGKYFSCFVAMCRRVCRMPAKPED
EPPDLA
S
LIEPITEERASRTLYRIELLRKIREQVLHHPQLSDRLKLCQPSLDLPEWWECGRHDRDLLVGAAKHGVS
R
TDYHILNDPELSFLDAHKSFAQNRGASTVPPLNTLAMGFGQTPPVISSAHVHEEKAMEQAEGKAEECEH
S
PAKERSDGKEEEEEAGGAKDGKQECEVEASSVKGELKGVEGSADPGSKSVSEKGSEEDEEEKLEDDDKS
E
ESSQPE
AGAVSRGKTFDEESNASLSTARDETRDGFYMEDGDASVAQLLHERTFAFSFWPKDRVMINRLD
N
ICEAVLKGKWPVNRRQMFDFQGLVPGYPPSAVDSPLQKRSFAELSMVSQASISASEDITTSPQLSK
DDA
L
NLSVPRQRRRRRRKVEIEAERAAKRRNLMEMVAQLRESQVVSENGQEKVVDLSKASREATSSTSNFSSL
T
SKFILPNVSTPVSDAFKSQMELLQAGLSRTPTRHMLNGSLVDGEPPMKRRRGRRKNVEGLDLLFMSHKR
T
PLSA
EDAEVTKAFEEDIETPPIRNIPSPGQLDPDTRIPVINLEDGTRLVGEDAPKNKDLVDWLKLHPTY
T
VDMPSYVP
KNTDVLFSSFQKPKQKRHRCRNPNKLDINTLTGEERVPVVNKRNGKKMGGAMAPPMKDLPR
W
LEENPEFAVAPDWTDIVKQS
GFVPESMFDRLLTGPVVRGEGASRRGRRPKSEIARAAAAAAAVASTSGI
N
PLLVNSLFAGMDLTSLQNLQNLQSLQLAGLMGFPPGLATAATAGGDAKSPAAVLPLMLPGMAGLPNVFG
L
GGLLNNPLSAATGNTTTASSQGEPEDGTSKAEEKGNDNEDENRDSEKSTDTVSAADSANGSVGAATAPA
A
LPSNPLAFNPFLLSTMAPGLFYPSMFLPPGLGGLTLPGFPALAGLQNAVGTSEEKAADKAEGGPCKDGE
T
LEGSDAEENLDKTVESSILEDEVAQGEELDSLEGGDEIENTGNDE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser