NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38617.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38617.1 Public Mus musculus 3 Abca4 21 106 86 CCDS HistoryNCBI Gene:11304Re-query CCDS DB by CCDS ID:38617.1Re-query CCDS DB by GeneID:11304See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38617.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000013995 ENSMUSP00000013995 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000013995Link to Ensembl Protein Viewer:ENSMUSP00000013995Re-query CCDS DB by Nucleotide ID:ENSMUST00000013995Re-query CCDS DB by Protein ID:ENSMUSP00000013995
Original member Current member EBI,WTSI OTTMUST00000074208 OTTMUSP00000038539 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074208Link to Vega Protein Viewer:OTTMUSP00000038539Re-query CCDS DB by Nucleotide ID:OTTMUST00000074208Re-query CCDS DB by Protein ID:OTTMUSP00000038539
Original member Current member NCBI NM_007378.1 NP_031404.1 Accepted alive Link to Nucleotide Sequence:NM_007378.1Link to Protein Sequence:NP_031404.1Re-query CCDS DB by Nucleotide ID:NM_007378Re-query CCDS DB by Protein ID:NP_031404Link to BLAST:NP_031404.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031404.1 2310 O35600 2310 100% 0 0

Chromosomal Locations for CCDS 38617.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 122044547 122044612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122052902 122052995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122054192 122054333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122055318 122055457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122062572 122062699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122068965 122069162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122080908 122080997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122083852 122084092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122085534 122085673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122086559 122086675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122087294 122087491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122102675 122102880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122103434 122103610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122105308 122105530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122110462 122110683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122112366 122112570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122116655 122116720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122120030 122120119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122121631 122121805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122123559 122123690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122126121 122126260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122126822 122126959 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122128125 122128318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122129316 122129400 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122132524 122132729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122133053 122133101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122135002 122135264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122136981 122137105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122137570 122137668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122138424 122138610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122141691 122141785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122143400 122143432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122147198 122147303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122147431 122147505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122147730 122147899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122148875 122149052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122155277 122155392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122156338 122156485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122157835 122157958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122158314 122158443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122162301 122162421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122162861 122162923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122163788 122163894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122166648 122166789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122169893 122170027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122170742 122170845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122170929 122171021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122173779 122174028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122176074 122176160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122179714 122179833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6933 nt):
ATGGGCTTCCTCAGACAGATACAGCTTTTGCTTTGGAAGAACTGGACTCTGAGGAAAAGGCAGAAGATTC
GC
TTTGTAGTGGAACTCGTGTGGCCTTTGTCTTTGTTTTTGGTGTTAATCTGGCTGAGGAATGCCAACCC
A
CTCTATAGTCAGCATGAATGCCATTTTCCCAACAAGGCGATGCCTTCAGCAGGACTGTTACCGTGGCTC
CAG
GGGATTTTCTGCAATATGAACAACCCTTGTTTTCAAAACCCCACCCCTGGAGAGTCTCCTGGAACTG
TC
TCAAACTATAACAACTCCATCTTGGCAAGAGTATATCGAGATTTTCAAGAACTCTTCATGGACACCCC
G
GAGGTCCAGCACCTTGGCCAGGTTTGGGCCGAGCTCCGCACCTTGTCGCAGTTCATGGACACCCTGAGG
ACT
CACCCTGAGAGATTTGCAGGAAGAGGATTACAAATCCGAGACATCCTAAAAGATGAAGAGGCGCTGA
CC
CTATTTCTCATGAGAAACATTGGCCTGTCTGACTCGGTTGCCCATCTTCTGGTCAACTCCCAAGTTCG
T
GTGGAGCAGTTTGCTTATGGAGTCCCAGACTTGGAACTGACAGACATTGCCTGCAGCGAGGCCCTCCTG
CAG
CGCTTCATCATCTTCAGCCAGCGTCGGGGGGCACAGACGGTACGCGATGCCCTGTGTCCCCTCTCCC
AG
GTCACCCTACAGTGGATAGAAGACACTCTGTATGCCGATGTGGACTTCTTCAAACTCTTCCATGTGCT
C
CCCACACTCCTGGACAGCAGTTCTCAAGGAATCAACTTGAGATTTTGGGGAGGAATATTATCTGATCTG
TCA
CCAAGAATGCAAAAGTTTATCCATCGGCCAAGTGTTCAAGACTTGCTATGGGTGAGCAGACCTCTCC
TG
CAGAACGGTGGTCCTGAGACCTTCACACAGCTGATGAGCATCCTGTCTGACCTCCTGTGTGGGTACCC
A
GAGGGAGGAGGCTCCCGAGTGTTCTCCTTTAACTGGTATGAAGACAATAACTATAAAGCCTTCCTGGGG
ATT
GATTCCACAAGGAAAGACCCCGCCTATTCTTACGACAAAAGAACAACATCCTTTTGTAATTCATTGA
TC
CAGAGCCTGGAGTCAAACCCTTTAACCAAAATAGCCTGGAGGGCGGCAAAGCCATTGCTGATGGGAAA
A
ATCCTCTTTACTCCAGATTCCCCTGCTGCTCGAAGGATAATGAAGAATGCCAACTCAACTTTTGAAGAA
CTG
GATCGAGTTAGGAAGTTGGTAAAAGCCTGGGAGGAAGTGGGGCCCCAGATCTGGTACTTCTTTGAGA
AG
AGCACACAGATGACCGTGATCCGAGACACCCTGCAGCACCCAACCGTCAAAGACTTCATAAATAGGCA
G
CTCGGAGAAGAAGGCATTACCACCGAAGCCGTATTAAACTTCTTCTCTAACGGTCCCCAAGAGAAGCAG
GCT
GATGATATGACCAGCTTTGACTGGAGGGACATATTCAACATCACTGACCGATTCCTACGCTTGGCTA
AT
CAATACCTGGAGTGTCTGGTCCTGGATAAGTTTGAAAGTTATGATGATGAAGTGCAGCTCACCCAACG
A
GCCCTGTCTCTCCTGGAGGAGAACAGGTTCTGGGCCGGAGTGGTGTTCCCTGGCATGTATCCCTGGGCC
AGC
TCCTTACCTCCTCATGTGAAGTACAAGATTCGGATGGACATAGATGTGGTGGAGAAGACCAATAAGA
TC
AAAGACAGGTACTGGGATTCTGGTCCCAGGGCGGATCCTGTCGAAGATTTCCGGTACATCTGGGGAGG
T
TTTGCCTATCTACAGGACATGGTGGAGCAAGGAATCGTGAAGAGTCAGATGCAGGCAGAGCCTCCAATT
GGA
GTCTATCTCCAACAGATGCCTTATCCCTGCTTTGTGGATGACTCCTTCATGATCATCCTGAATCGCT
GT
TTCCCTATCTTCATGGTGCTGGCGTGGATCTACTCTGTCTCCATGACCGTTAAGGGCATTGTTTTGGA
G
AAGGAGCTGAGGCTGAAGGAGACCTTGAAAAACCAAGGCGTCTCTAATGCTGTCATCTGGTGTACCTGG
TTC
CTGGATAGCTTCTCCATCATGGCGCTGAGTATCTTCCTCCTGACGCTGTTCATCATGCATGGAAGGA
TC
CTCCATTACAGCGATCCCTTCATTCTCTTCCTGTTCTTGTTGGCCTTTGCCACTGCGACCATCATGCA
G
AGCTTCCTGCTCAGTACTTTGTTTTCCAAGGCCAGCCTTGCAGCAGCCTGCAGTGGGGTCATCTACTTC
ACC
CTCTACCTACCACACGTTCTGTGCTTTGCCTGGCAGGACCGGATGACGGCCGACCTGAAGACGACTG
TG
AGCCTACTTTCTTCCGTGGCATTTGGGTTTGGCACCGAGTACCTGGTCCGCTTTGAGGAGCAAGGCCT
G
GGGCTGCAATGGAGCAACATTGGGAAGAGTCCCCTGGAAGGGGATGAGTTCAGTTTCCTGCTGTCTATG
AAG
ATGATGCTTCTCGATGCTGCTCTCTACGGCTTGCTTGCTTGGTATCTTGACCAGGTTTTCCCAGGAG
AC
TATGGGACCCCACTTCCCTGGTACTTCCTTCTGCAGGAGTCCTACTGGCTTGGTGGTGAAGGTTGTTC
G
ACCAGAGAAGAAAGGGCTCTGGAAAAGACTGAACCCTTAACAGAGGAGATGGAGGATCCAGAGCACCCA
GAA
GGAATGAATGACTCCTTTTTTGAACGCGAGCTTCCAGGGCTGGTGCCTGGTGTGTGTGTGAAGAACC
TG
GTGAAGGTTTTTGAGCCCAGTGGCCGGCCAGCTGTGGACCGTCTGAACATCACTTTCTATGAGAACCA
A
ATCACGGCGTTCCTGGGTCACAACGGAGCGGGAAAGACCACCACCTTGTCCATCCTGACAGGACTGTTG
CCA
CCGACGTCAGGAACTGTGCTCATTGGGGGAAAAGACATTGAAACCAACCTGGATGTAGTACGGCAGA
GC
CTGGGCATGTGTCCACAACACAACATCCTGTTTCATCACCTCACGGTGGCTGAGCACATCTTGTTCTA
T
GCCCAGCTGAAAGGGAGATCCTGGGAGGAGGCCCAGCTTGAGATGGAAGCCATGCTAGAAGACACGGGC
CTC
CACCATAAGAGGAATGAAGAAGCTCAGGACCTTTCAGGTGGCATGCAGAGGAAGCTGTCTGTTGCCA
TT
GCTTTTGTGGGAGATTCTAAGGTGGTGGTCCTGGATGAGCCCACCTCTGGGGTGGACCCCTACTCCAG
A
CGCTCCATCTGGGACCTGCTCCTGAAGTATCGCTCAGGCAGAACCATCATCATGTCCACTCACCACATG
GAC
GAGGCAGACCTCCTTGGGGACCGCATTGCCATCATTTCTCAGGGAAGGCTCTACTGCTCTGGAACCC
CG
CTCTTCCTCAAGAACTGCTTTGGCACAGGCTTCTACTTGACCTTAGTTCGCAAGATGAAAAACATCCA
G
AGCCAAAGAGGTGGCTGTGAGGGGGTCTGCAGCTGTACATCAAAGGGTTTCTCTACCAGGTGTCCAACC
CGA
GTCGATGAGATAACAGAAGAACAAGTCCTGGATGGAGATGTGCAGGAGCTGATGGATTTGGTATACC
AC
CATGTCCCAGAGGCAAAGCTGGTGGAATGCATTGGTCAAGAACTTATCTTCCTCCTTCCAAACAAGAA
T
TTCAAGCAGAGAGCATATGCCAGCCTTTTCCGAGAGCTGGAGGAGACTCTGGCTGACCTGGGGCTCAGC
AGC
TTTGGAATTTCTGACACTCCCCTGGAAGAGATTTTCCTGAAGGTCACAGAGGATGCTGGAGCGGGCT
CT
ATGTTTGTAGGTGGCGCTCAGCAGAAAAGAGAACAAGCCGGTCTCCGGCACCCTTGTTCGGCTCCCAC
T
GAGAAGCTCAGGCAGTATGCCCAGGCCCCACATACCTGTTCCCCAGGACAAGTGGATCCTCCCAAGGGC
CAA
CCTTCCCCAGAGCCAGAGGACCCCGGTGTCCCATTCAACACAGGTGCTCGGCTGATTCTTCAACATG
TG
CAGGCCCTGCTAGTCAAGCGATTCCATCACACCATCCGCAGCCGCAAGGACTTTGTGGCTCAGATTGT
T
CTCCCTGCCACTTTCGTGTTCTTGGCTCTGATGCTTTCAATCATTGTGCCTCCGTTTGGTGAATTTCCA
GCT
TTGACTCTTCATCCCTGGATGTATGGGCATCAATATACCTTCTTCAGCATGGACGAACCCAACAATG
AA
CACCTTGAAGTACTGGCAGATGTCCTTCTGAACAGGCCAGGCTTTGGCAACCGTTGTCTAAAGGAAGA
G
TGGCTTCCGGAGTACCCATGCATTAATGCAACCTCCTGGAAGACGCCCTCCGTGTCCCCGAACATCACC
CAC
CTGTTCCAGAAGCAGAAATGGACAGCAGCCCACCCCTCTCCCTCCTGCAAGTGCAGCACCAGAGAGA
AG
CTCACCATGTTGCCCGAGTGCCCCGAGGGTGCTGGAGGGCTCCCACCCCCACAGAGGACACAGCGCAG
C
ACTGAAGTCCTACAAGACCTCACGAACAGGAACATCTCCGACTACTTGGTAAAAACGTACCCTGCTCTC
ATA
AGAAGCAGCTTAAAGAGCAAATTCTGGGTCAATGAACAGAGGTATGGAGGAATTTCCATCGGAGGAA
AA
CTCCCTGCTATCCCCATCAGCGGGGAAGCACTTGTTGGCTTTCTAAGTGGCCTTGGCCAGATGATGAA
C
GTGAGCGGGGGTCCTGTCACCAGGGAGGCCTCCAAAGAAATGTTAGATTTCCTCAAACATCTTGAAACC
ACA
GACAACATTAAGGTATGGTTTAACAACAAGGGCTGGCATGCCCTGGTCAGCTTTCTGAATGTGGCTC
AC
AACGCCATCTTACGGGCCAGCCTGCCCAGGGACAGGGACCCTGAGGAGTATGGAATCACTGTCATCAG
C
CAGCCTCTGAACCTGACCAAGGAGCAGCTCTCGGACATCACAGTACTGACTACTTCCGTGGATGCCGTG
GTT
GCCATATGTGTGATTTTCGCCATGTCCTTCGTTCCAGCCAGCTTTGTCCTTTACTTGATCCAGGAGA
GG
GTGACGAAAGCTAAACATTTGCAGTTTATCAGTGGTGTGAGCCCCACCACCTACTGGCTGACCAACTT
C
CTCTGGGATATTATGAATTATGCTGTGAGTGCGGGATTGGTGGTGGGCATCTTCATTGGATTTCAAAAG
AAA
GCCTACACATCCCCAGACAACCTTCCTGCTCTCGTCTCTCTGCTCATGCTGTATGGATGGGCAGTCA
TT
CCTATGATGTATCCAGCATCCTTCCTGTTTGAAGTCCCCAGCACAGCCTATGTGGCTTTGTCCTGTGC
T
AACCTGTTCATCGGCATCAACAGCAGCGCCATCACCTTCGTCCTGGAATTATTTGAGAATAACCGGACG
CTG
CTCAGGTTCAATGCCATGTTGAGGAAGTTGCTCATTGTCTTCCCCCACTTCTGCCTGGGCAGGGGCC
TC
ATTGACCTGGCACTGAGCCAAGCTGTGACAGACGTCTATGCCCAGTTTGGTGAGGAGTACTCTGCAAA
C
CCATTCCAGTGGGACCTGATTGGGAAGAACCTGGTTGCTATGGCAATAGAAGGGGTGGTATACTTCCTT
CTG
ACCCTGCTCATCCAACACCATTTTTTCCTCACCCGGTGGATCGCTGAGCCTGCTAGAGAGCCCGTTT
TT
GATGAAGATGACGATGTGGCTGAAGAAAGACAAAGAGTTATGAGTGGGGGAAATAAAACCGACATCTT
A
AAGCTAAACGAACTAACCAAGGTTTACTCAGGCTCTTCCAGTCCAGCAGTAGATCGGTTATGTGTTGGA
GTT
CGACCTGGAGAGTGCTTTGGCCTCCTGGGAGTGAATGGTGCAGGCAAAACCACCACATTCAAGATGC
TC
ACTGGGGACACCACAGTGACATCGGGGGATGCTACTGTGGCAGGCAAGAGCATTTTAACTAGTATTTC
T
GATGTCCATCAAAACATGGGCTACTGTCCTCAGTTTGATGCAATCGATGACCTGCTCACAGGCAGAGAA
CAC
CTTTACCTCTATGCCAGGCTGCGGGGCGTGCCATCGAAGGAAATCGAGAAGGTTGCCAACTGGGGTA
TC
CAGAGCCTGGGCTTGTCTCTCTACGCTGACCGCCTGGCAGGCACCTACAGTGGAGGCAATAAGAGGAA
A
CTCTCTACAGCCATAGCTCTCACTGGCTGCCCTCCCCTGCTGCTGCTGGATGAGCCCACGACAGGGATG
GAT
CCCCAGGCACGCCGCATGCTGTGGAACACCATTGTGAGCATCATCAGAGAAGGGAGAGCTGTGGTTC
TC
ACCTCCCACAGCATGGAAGAATGTGAAGCTCTGTGTACGCGGCTGGCCATCATGGTGAAGGGCACCTT
T
CAGTGTCTGGGTACCATCCAACACCTCAAGTACAAGTTTGGAGACGGCTACATTGTCACAATGAAAATC
AAA
TCTCCAAAGGACGACTTGCTTCCCGATTTGAATCCTGTGGAGCAGTTCTTCCAGGGCAACTTCCCTG
GC
AGCGTGCAGAGGGAGAGACACCACAGCATGCTCCAGTTCCAGGTCCCCTCGTCCTCCCTGGCCAGGAT
C
TTCCAGCTGCTCATTTCCCACAAGGACAGCCTGCTCATCGAGGAGTACTCAGTCACCCAGACCACGCTG
GAC
CAGGTGTTTGTAAACTTCGCTAAACAGCAGACTGAGACCTATGACCTCCCTCTGCACCCCCGGGCTG
CT
GGAGCCAGCTGGCAAGCCAAGCTTGAAGAGAAATCCGGACGGCTGCAGACACAGGAGCCTTTGCCCGC
A
GGATCTGAACAACTGGCTAACGGAAGCAACCCCACGGCAGCAGAAGATAAGCACACCAGGAGTCCACAG
TGA


Translation (2310 aa):
MGFLRQIQLLLWKNWTLRKRQKIRFVVELVWPLSLFLVLIWLRNANPLYSQHECHFPNKAMPSAGLLPWL
Q
GIFCNMNNPCFQNPTPGESPGTVSNYNNS
ILARVYRDFQELFMDTPEVQHLGQVWAELRTLSQFMDTLR
T
HPERFA
GRGLQIRDILKDEEALTLFLMRNIGLSDSVAHLLVNSQVRVEQFAYGVPDLELTDIACSEALL
Q
RFIIFSQRRGAQTVRDALCPLSQVTLQWIEDTLYADVDFFKLFHV
LPTLLDSSSQGINLRFWGGILSDL
S
PRMQK
FIHRPSVQDLLWVSRPLLQNGGPETFTQLMSILSDLLCGYPEGGGSRVFSFNWYEDNNYKAFLG
I
DSTRKDPAYSYDKRT
TSFCNSLIQSLESNPLTKIAWRAAKPLLMGKILFTPDSPAARRIMKNANSTFEE
L
DRVRKLVKAWEEVGPQIWYFFEKSTQMTVIR
DTLQHPTVKDFINRQLGEEGITTEAVLNFFSNGPQEKQ
A
DDMTSFDWRDIFNITDRFLRLANQYLE
CLVLDKFESYDDEVQLTQRALSLLEENRFWAGVVFPGMYPWA
S
SLPPHVKYKIRMDIDVVEKTNKIKD
RYWDSGPRADPVEDFRYIWGGFAYLQDMVEQGIVKSQMQAEPPI
G
VYLQQMPYPCFVDD
SFMIILNRCFPIFMVLAWIYSVSMTVKGIVLEKELRLKETLKNQGVSNAVIWCTW
F
LDSFSIMALSIFLLTLFIM
HGRILHYSDPFILFLFLLAFATATIMQSFLLSTLFSKASLAAACSGVIYF
T
LYLPHVLCFAWQDRMTADLKTTV
SLLSSVAFGFGTEYLVRFEEQGLGLQWSNIGKSPLEGDEFSFLLSM
K
MMLLDAALYGLLAWYLDQVFP
GDYGTPLPWYFLLQESYWLGGEGCSTREERALEKTEPLTEEMEDPEHP
E
GMN
DSFFERELPGLVPGVCVKNLVKVFEPSGRPAVDRLNITFYENQITAFLGHNGAGKTTTLSILTGLL
P
PTSGTVLIGGKDIETNLDVVRQSLGMCPQHNILFH
HLTVAEHILFYAQLKGRSWEEAQLEMEAMLEDTG
L
HHKRNEEAQDLS
GGMQRKLSVAIAFVGDSKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHM
D
EADLLGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCE
GVCSCTSKGFSTRCPT
R
VDEITEEQVLD
GDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLS
S
FGISDTPLEE
IFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDPPKG
Q
PSPEPEDPGVPFNTGARLILQHVQALLVKRFHHTIRSRKDFVAQ
IVLPATFVFLALMLSIIVPPFGEFP
A
LTLHPWMYGHQYTFF
SMDEPNNEHLEVLADVLLNRPGFGNRCLKEEWLPEYPCINATSWKTPSVSPNIT
H
LFQKQKWTAAHPSPSCKCSTREKLTMLPECPEGAGGLPPPQ
RTQRSTEVLQDLTNRNISDYLVKTYPAL
I
RS
SLKSKFWVNEQRYGGISIGGKLPAIPISGEALVGFLSGLGQMMNVSGGPVTREASKEMLDFLKHLET
T
DNIK
VWFNNKGWHALVSFLNVAHNAILRASLPRDRDPEEYGITVISQPLNLTKEQLSDITVLTTSVDAV
V
AICVIFAMSFVPASFVLYLIQERVTKAKHLQFISGVSPTTYWLTNFLWDI
MNYAVSAGLVVGIFIGFQK
K
AYTSPDNLPALVSLLMLY
GWAVIPMMYPASFLFEVPSTAYVALSCANLFIGINSSAITFVLELFENNRT
L
LRFNAMLRKLLIVFPHFCLGRGLIDLALSQAVTDVYAQF
GEEYSANPFQWDLIGKNLVAMAIEGVVYFL
L
TLLIQHHFFLTR
WIAEPAREPVFDEDDDVAEERQRVMSGGNKTDILKLNELTKVYSGSSSPAVDRLCVG
V
RPGE
CFGLLGVNGAGKTTTFKMLTGDTTVTSGDATVAGKSILTSISDVHQNMGYCPQFDAIDDLLTGRE
H
LYLYARLRGVPSKEIEK
VANWGIQSLGLSLYADRLAGTYSGGNKRKLSTAIALTGCPPLLLLDEPTTGM
D
PQARRMLWNTIVSIIREGRAVVLTSH
SMEECEALCTRLAIMVKGTFQCLGTIQHLKYKFGDGYIVTMKI
K
SPKDDLLPDLNPVEQFFQGNFPGSVQRERHHSMLQFQVPSSSLARIFQLLISHKDSLLIEEYSVTQTTL
D
Q
VFVNFAKQQTETYDLPLHPRAAGASWQAKLEEKSGRLQTQEPLPAGSEQLANGSNPTAAEDKHTRSPQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser