NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38504.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38504.2 Public Mus musculus 3 S100a13 21 106 86 CCDS HistoryNCBI Gene:20196Re-query CCDS DB by CCDS ID:38504.2Re-query CCDS DB by GeneID:20196See the combined annotation on chromosome 3 in Sequence Viewer

Public Note for CCDS 38504.1
The coding region has been updated to extend the N-terminus based on the 5'-most in-frame start codon found in available transcript data. It should be noted that this start codon appears to be mouse-specific, whereas the downstream start codon is better conserved, but the upstream start codon has a strong Kozak signal and may be used in mouse according to the ribosome scanning model for translation.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 38504.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000048138 ENSMUSP00000047737 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048138Link to Ensembl Protein Viewer:ENSMUSP00000047737Re-query CCDS DB by Nucleotide ID:ENSMUST00000048138Re-query CCDS DB by Protein ID:ENSMUSP00000047737
Original member Current member EBI,WTSI OTTMUST00000052486 OTTMUSP00000024894 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000052486Link to Vega Protein Viewer:OTTMUSP00000024894Re-query CCDS DB by Nucleotide ID:OTTMUST00000052486Re-query CCDS DB by Protein ID:OTTMUSP00000024894
Original member Current member NCBI NM_009113.4 NP_033139.2 Accepted alive Link to Nucleotide Sequence:NM_009113.4Link to Protein Sequence:NP_033139.2Re-query CCDS DB by Nucleotide ID:NM_009113Re-query CCDS DB by Protein ID:NP_033139Link to BLAST:NP_033139.2

Chromosomal Locations for CCDS 38504.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 90514874 90515019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 90515850 90516042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 90524353 90524496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (483 nt):
ATGGCTAGTGACAGCAGGGGCGGTCCCCTCAGCGGAGGCGGAAACTTGACACTTCAGACTTGGGAGTGGC
TC
TCGCCTTGCCTGGTGCTTATAAACTTCAGCCTCAGGGCTCCAGATCGGTTAGCTGCATCCCACCTTCT
T
TCCCGGTCAATCTGTGTGGACATCAGCTCCTGCTTTGGTATACTGATGGCAGCAGAGACTCTGACTGAA
CTG
GAGGCGGCCATTGAGACTGTGGTCTCTACTTTCTTCACCTTTGCAGGGCGGGAAGGACGCAAAGGCA
GC
CTGAACATCAATGAATTTAAGGAACTGGCCACTCAGCAACTGCCTCATTTGCTCAAGGACGTGGGCTC
T
CTAGATGAAAAGATGAAGACCTTGGATGTGAATCAGGACTCAGAGCTGAGGTTCAGTGAATACTGGAGA
CTG
ATTGGAGAGCTGGCAAAGGAAGTCAGGAAGGAGAAGGCCCTGGGGATCCGGAAGAAGTAA


Translation (160 aa):
MASDSRGGPLSGGGNLTLQTWEWLSPCLVLINFSLRAPDRLAASHLLSRSICVDISSCFGILMAAETLTE
L
EAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLK
DVGSLDEKMKTLDVNQDSELRFSEYWR
L
IGELAKEVRKEKALGIRKK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser