NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38487.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38487.1 Public Mus musculus 3 Dpm3 21 106 86 CCDS HistoryNCBI Gene:68563Re-query CCDS DB by CCDS ID:38487.1Re-query CCDS DB by GeneID:68563See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38487.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040824 ENSMUSP00000040860 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040824Link to Ensembl Protein Viewer:ENSMUSP00000040860Re-query CCDS DB by Nucleotide ID:ENSMUST00000040824Re-query CCDS DB by Protein ID:ENSMUSP00000040860
Original member Current member EBI,WTSI ENSMUST00000107462 ENSMUSP00000103086 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107462Link to Ensembl Protein Viewer:ENSMUSP00000103086Re-query CCDS DB by Nucleotide ID:ENSMUST00000107462Re-query CCDS DB by Protein ID:ENSMUSP00000103086
Original member Current member EBI,WTSI OTTMUST00000053018 OTTMUSP00000025186 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000053018Link to Vega Protein Viewer:OTTMUSP00000025186Re-query CCDS DB by Nucleotide ID:OTTMUST00000053018Re-query CCDS DB by Protein ID:OTTMUSP00000025186
Original member Current member NCBI NM_026767.4 NP_081043.1 Accepted alive Link to Nucleotide Sequence:NM_026767.4Link to Protein Sequence:NP_081043.1Re-query CCDS DB by Nucleotide ID:NM_026767Re-query CCDS DB by Protein ID:NP_081043Link to BLAST:NP_081043.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081043.1 92 Q9D1Q4 92 100% 0 0

Chromosomal Locations for CCDS 38487.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 89266734 89267012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (279 nt):
ATGACGAAGTTAACACAGTGGCTTTGGGGACTGGCTCTCCTGGGCTCTGCCTGGGCTGCCCTGACCATGG
GA
GCACTGGGCTTGGAGTTGCCTTTCCCCTGCCGAGAGGTCCTGTGGCCACTGCCTGCCTACCTGTTGGT
C
TCCGCTGGCTGCTATGCCCTGGGCACGGTGGGCTATCGCGTAGCTACATTTCACGACTGCGAGGACGCT
GCC
CGAGAGCTGCAGAGCCAGATCGTGGAGGCCCGAGCTGATTTAGCACGCAGGGGGCTGCGCTTCTGA


Translation (92 aa):
MTKLTQWLWGLALLGSAWAALTMGALGLELPFPCREVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDA
A
RELQSQIVEARADLARRGLRF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser