NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38417.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38417.1 Public Mus musculus 3 Bbs12 21 106 86 CCDS HistoryNCBI Gene:241950Re-query CCDS DB by CCDS ID:38417.1Re-query CCDS DB by GeneID:241950See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38417.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000057975 ENSMUSP00000052179 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000057975Link to Ensembl Protein Viewer:ENSMUSP00000052179Re-query CCDS DB by Nucleotide ID:ENSMUST00000057975Re-query CCDS DB by Protein ID:ENSMUSP00000052179
Original member Current member EBI,WTSI OTTMUST00000017069 OTTMUSP00000051346 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000017069Link to Vega Protein Viewer:OTTMUSP00000051346Re-query CCDS DB by Nucleotide ID:OTTMUST00000017069Re-query CCDS DB by Protein ID:OTTMUSP00000051346
Original member Current member NCBI NM_001008502.2 NP_001008502.2 Accepted alive Link to Nucleotide Sequence:NM_001008502.2Link to Protein Sequence:NP_001008502.2Re-query CCDS DB by Nucleotide ID:NM_001008502Re-query CCDS DB by Protein ID:NP_001008502Link to BLAST:NP_001008502.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001008502.2 708 Q5SUD9 708 100% 0 0

Chromosomal Locations for CCDS 38417.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 37319060 37321186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2127 nt):
ATGGAGATGGCTTGCAGGGTCATAAACAGAAGAAGGCATGTGGGACTTCAACAACTTTTGTCATTTGCAC
AA
ACAGGAAGAAGTTTCCTAGGTCCAGTAAAAGCCACCAAGTTTATTACAGATGCAGAGTGTCATGAAAG
T
GTGTTGATCAGCTCAACAGTCAGGCTTCTAGAAGGATTGGATTTAACCTGTGCAGTGGGGCACCTTCTC
AAC
GAAGCAGTTCAAGCACAGAATAACACATACAAAATTGGAACCAGCACTCTTTTGTTTCTTGTCGGTG
CA
TGGAGCAGGGCTGTTGAAGATTGTCTCCATCTGGGGATTCCCACTACAGTAATAGTGTCGGTAATGTC
A
GAAGGCTTGAACTCTTGCATTGAAGCAGTAGTTTCTCTTCAAGTACCCATACACAATGTATTTGACCAC
ATG
GACAACACAAGTACAGTTTACAAACTTGAAACAGTTAATGCCACTTTGTGTCCTTTTCTACAAGACC
CT
TCAGGTTCTGGGTTGTTACAGGAAAAGCGTGATTTCAAAGATGCTACATCTCCGTTATTGTCCACTTA
C
AGTCTTTCTGGGAGACATGCTGAGTCACCCAAATTCTTCAAACCTCAGAATAATCTTGAAACAGAAAAA
AAC
ACATTGCAAGTTTTGAAAAACAATCTATATACAGATTCCTTCTGCAAAAAGTCAGCACTAGCTCACA
GT
AGGCATTTTAATAGGACAGATAATAGCCACTGGATAAGCCGACATGATGGATTTCTAGAACAACTTGA
A
TCAACTCCGAAAGTACTTAGATGTAATGATTTTGGGGAGTTAGCAGTTGGCTTGAGCCATGGAGATCAC
AGC
AGCATGGCATTGGCCAAAGCAGCAGTGAGGTTGCAGTGGCAGAGTCTGTGTCTGCAGCAAGCCAACT
GG
ATGGCACCCTTTATGTTTGATATTTCAAGACTTCTCACTTGCTGTATTCCAGGTCTACCTGAAACTTT
T
TCCCGTGTTGGTCTAGGATATGTCACTTTTGTTACCATGTCTAGTATTACTCTTATCAAGGAATTGCAG
GAT
CAGCCTTTCCGAGTGATTCTCATTGAGGGTGACCTCACAGAGAGTTACCGACACCTGGGATTTAATA
AG
TCTGTAAATATTAAGACTAAGTTAGATAGTGGGGAGCTTTCAGAAGATAGTGCAGAAGAACTGTGGAC
A
AATCATGTGTTACAGGTGTTAATCCAGTTCAATGTGACCCTCATCTTGGTACAAGGAAGTGTATCAGAA
CAC
TTGACTGAAAAATGCATGCACAGTAAGCGGCTGGTAATTGGGGCAGTGAATGGCAGTGTGTTGCAGG
CA
TTTGCAGAGGCCACAAGAGCAGTGCCAGTAGCCTATGTTACACAAGTGAATGAAGACTGTGTAGGCAG
C
GGGGTCTCTGTGACCTTCTGGATGAGTCCTCATGATATAAACAGGAGCAACAGAATAGCAATCTTGTTA
ACA
GCAGAAGGAATTAATTTGATTACAGCAGTACTTACTAGTCCAGCAAGTGCTCAGATGGAAACCAAGG
AA
GACAGGTTCTGGTCTTGTGTGTATCGTTTATATCATGCCCTAAAAGAAGAGAAGGTCTTCCTTGGCGG
T
GGTGCTGTTGAATTTTTATGTCTTAGCCATCTTCAAATTCTTGCTGAGCAATCTTTAAATAGAGGAAAC
CAT
GCTTGTTTAGGATGGCTTCCTGATTCTTCCTCTTGGATGGCCTCATCTCTGTCCGTCTACAGACCTA
CT
GTGCTGAAGTCCCTGGCAGGTGGGTGGCATGAATTCCTGTCAGCTATCATGTGTAACACTGCCACTCA
C
CCATCAGCAGTGGAAGCTAGGACATTCATTCAACAACATGTACAAAATGCCATTGACTCTGGCTCCCCT
TCA
TCTTACATCTTGAGTGAATATAGTAAACTAAGTAGTGGAGTTTTTCATTCAGGTATTTCAGATAACC
TG
GAGCTGGTTCCAAGAGTTTATGATACTGTTACACCAAAGATTGAAGCATGGCGCCGAGCATTGGATGT
A
GTGCTCTTAGTGCTTCAGACAGACAGTGAAATAATTACTGGACTTGTACACACAGAGATGAATTCACAG
GAA
TTAGATGGAGTTTTATTTTTGTAG


Translation (708 aa):
MEMACRVINRRRHVGLQQLLSFAQTGRSFLGPVKATKFITDAECHESVLISSTVRLLEGLDLTCAVGHLL
N
EAVQAQNNTYKIGTSTLLFLVGAWSRAVEDCLHLGIPTTVIVSVMSEGLNSCIEAVVSLQVPIHNVFDH
M
DNTSTVYKLETVNATLCPFLQDPSGSGLLQEKRDFKDATSPLLSTYSLSGRHAESPKFFKPQNNLETEK
N
TLQVLKNNLYTDSFCKKSALAHSRHFNRTDNSHWISRHDGFLEQLESTPKVLRCNDFGELAVGLSHGDH
S
SMALAKAAVRLQWQSLCLQQANWMAPFMFDISRLLTCCIPGLPETFSRVGLGYVTFVTMSSITLIKELQ
D
QPFRVILIEGDLTESYRHLGFNKSVNIKTKLDSGELSEDSAEELWTNHVLQVLIQFNVTLILVQGSVSE
H
LTEKCMHSKRLVIGAVNGSVLQAFAEATRAVPVAYVTQVNEDCVGSGVSVTFWMSPHDINRSNRIAILL
T
AEGINLITAVLTSPASAQMETKEDRFWSCVYRLYHALKEEKVFLGGGAVEFLCLSHLQILAEQSLNRGN
H
ACLGWLPDSSSWMASSLSVYRPTVLKSLAGGWHEFLSAIMCNTATHPSAVEARTFIQQHVQNAIDSGSP
S
SYILSEYSKLSSGVFHSGISDNLELVPRVYDTVTPKIEAWRRALDVVLLVLQTDSEIITGLVHTEMNSQ
E
LDGVLFL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser