NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38401.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38401.1 Public Mus musculus 3 Cp 21 106 86 CCDS HistoryNCBI Gene:12870Re-query CCDS DB by CCDS ID:38401.1Re-query CCDS DB by GeneID:12870See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38401.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000091309 ENSMUSP00000088857 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000091309Link to Ensembl Protein Viewer:ENSMUSP00000088857Re-query CCDS DB by Nucleotide ID:ENSMUST00000091309Re-query CCDS DB by Protein ID:ENSMUSP00000088857
Original member Current member EBI,WTSI OTTMUST00000057274 OTTMUSP00000027617 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057274Link to Vega Protein Viewer:OTTMUSP00000027617Re-query CCDS DB by Nucleotide ID:OTTMUST00000057274Re-query CCDS DB by Protein ID:OTTMUSP00000027617
Original member Current member NCBI NM_007752.3 NP_031778.2 Accepted alive Link to Nucleotide Sequence:NM_007752.3Link to Protein Sequence:NP_031778.2Re-query CCDS DB by Nucleotide ID:NM_007752Re-query CCDS DB by Protein ID:NP_031778Link to BLink:NP_031778.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031778.2 1061 Q61147 1061 100% 0 0

Chromosomal Locations for CCDS 38401.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 19957284 19957429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19964280 19964527 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19966239 19966448 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19968040 19968213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19969776 19970030 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19970912 19971083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19972615 19972754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19973777 19973929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19974859 19975058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19977096 19977246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19978860 19979072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19980591 19980798 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19981963 19982102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19983393 19983521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19985560 19985666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19987359 19987575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19987933 19988072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19989053 19989218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 19992509 19992525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3186 nt):
ATGAAGTTTTTGCTGCTTAGCACATTTATATTTTTGTATAGTTCCTTAGCCTTGGCAAGAGATAAGCATT
AT
TTCATTGGAATTACTGAAGCAGTCTGGGACTATGCTTCTGGCACTGAAGAAAAGAAACTTATTTCAGT
T
GACACGGAACAGTCCAATTTCTATCTTCAAAATGGTCCAGATCGTATTGGAAGAAAATATAAGAAGGCC
CTT
TATTTTGAGTACACAGATGGCACCTTTAGTAAGACTATAGACAAACCAGCCTGGCTAGGGTTTTTAG
GC
CCTGTCATCAAAGCTGAAGTTGAAGATAAAGTTTATGTTCACTTAAAGAACCTTGCCTCTAGGATCTA
C
ACTTTTCATGCACATGGGGTAACGTACACCAAGGAGTATGAGGGAGCCGTCTACCCTGACAACACCACT
GAT
TTTCAACGGGCTGATGACAAAGTGCTTCCCGGACAACAGTATGTGTATGTGCTGCATGCCAATGAGC
CA
AGTCCTGGAGAGGGAGACAGCAATTGTGTGACCAGGATTTACCACTCCCATGTTGATGCTCCAAAAGA
T
ATTGCATCAGGACTCATAGGACCTCTAATACTCTGTAAAAAAGGTTCTCTATATAAGGAAAAAGAGAAA
AAT
ATTGACCAAGAATTTGTACTAATGTTCTCTGTGGTGGATGAAAATCTCAGCTGGTATCTGGAAGATA
AC
ATCAAAACCTTCTGCTCTGAACCCGAGAAAGTTGATAAAGACAATGAAGACTTCCAGGAAAGCAACAG
G
ATGTACTCTATAAATGGATATACATTTGGAAGCCTCCCAGGGCTCTCGATGTGTGCAGCAGACAGAGTG
AAG
TGGTACCTTTTTGGTATGGGTAATGAAGTTGATGTGCATTCAGCTTTCTTTCATGGCCAAGCCCTGA
CC
AGCAGGAACTATCAAACCGATATAATCAACCTGTTCCCTGCCACCCTAATTGATGCTTATATGGTGGC
C
CAGAATCCTGGAGTCTGGATGCTCAGTTGCCAGAACCTAAACCATCTGAAAGCTGGGTTGCAGGCCTTT
TTC
CAGGTTCGTGACTGTAACAAGCCCTCGCCAGAGGATAATATCCAAGATAGGCATGTGAGACACTATT
AC
ATTGCTGCTGAGGAGGTCATCTGGAATTATGCTCCTTCTGGGACGGACATCTTCACTGGAGAGAATTT
A
ACAGCTCTGGAAAGTGATTCAAGGGTATTTTTTGAGCAAGGTGCCACAAGAATTGGTGGCTCTTATAAA
AAA
ATGGCATATCGTGAGTACACAGATGGTTCCTTCACAAACCGAAAACAAAGAGGCCCTGATGAGGAAC
AT
CTTGGAATCCTAGGTCCTGTCATTTGGGCAGAAGTAGGAGACACCATTAAAGTCACCTTTCATAACAA
A
GGACAGCATCCTCTCAGCATTCAGCCAATGGGAGTAAGTTTCACTGCAGAAAATGAGGGAACATACTAT
GGC
CCACCAGGTCGCTCCTCACAGCAAGCAGCCTCCCATGTGGCTCCCAAAGAAACCTTTACATACGAAT
GG
ACTGTCCCCAAAGAAATGGGACCCACTTATGCAGATCCTGTGTGCCTATCTAAGATGTACTACTCTGG
C
GTTGACCCCACCAAAGATATATTTACTGGGCTTATTGGGCCAATGAAAATATGCAAGAAAGGCAGCTTA
CTT
GCTGATGGGAGACAGAAAGATGTAGACAAAGAGTTCTACTTGTTTCCCACAGTGTTTGATGAGAATG
AG
AGTTTACTCTTAGATGATAATATCAGGATGTTCACAACTGCACCTGATCAAGTGGATAAGGAAGATGA
A
GACTTTCAGGAGTCTAATAAGATGCACTCCATGAATGGGTTCATGTATGGCAATCAGCCTGGCCTCAAT
ATG
TGTCTAGGAGAATCCATCGTGTGGTATTTGTTCAGCGCTGGAAATGAGGCTGATGTGCATGGGATAT
AC
TTTTCAGGAAATACTTATCTGTCTAAAGGAGAAAGAAGAGACACTGCAAACCTATTCCCTCATAAAAG
T
CTCACCCTTCTCATGAACCCTGACACAAAAGGGACTTTTGATGTTGAGTGCCTTACAACGGATCACTAC
ACA
GGTGGCATGAAGCAAAAATACACTGTGAACCAGTGCCAGCGGCAGTTTGAAGATTTCACTGTCTACC
TT
GGAGAAAGGACCTACTATGTGGCAGCCGTAGAGGTGGAATGGGATTACTCACCAAGCAGGGCCTGGGA
A
AAGGAGCTGCATCATTTGCAAGAGCAAAATGTTTCAAATGTATTTTTGGATAAAGAAGAGTTTTTCATA
GGC
TCAAAGTACAAGAAGGTTGTGTATCGCCAGTTTACTGACAGCTCATTCAGAGAACAGGTGAAGAGAC
GA
GCCGAAGACGAGCACTTGGGCATCCTTGGGCCACCAATTCATGCAAATGTTGGAGACAAAGTTAAAGT
T
GTCTTTAAAAATATGGCAACCAGGCCATATTCAATACATGCCCATGGGGTGAAAACAGAGAGTTCTACA
GTT
GTTCCAACGTTACCAGGTGAAGTTCGAACTTATACATGGCAAATTCCAGAAAGATCAGGGGCTGGAA
GA
GAGGATTCAGCTTGTATCCCATGGGCTTATTACTCAACTGTGGATCGAGTTAAGGATCTCTATAGTGG
G
CTAATAGGCCCATTGATTGTTTGTCGGAAGTCTTATGTGAAAGTATTCAGTCCTAAAAAGAAAATGGAG
TTT
TTCCTTCTGTTTCTAGTATTTGATGAGAATGAATCTTGGTACTTAGATGATAACATCAAAACATACT
CT
GAACACCCTGAGAAAGTAAACAAAGACAACGAGGAATTCCTAGAAAGCAATAAAATGCATGCTATTAA
T
GGGAAAATGTTTGGAAACCTACAAGGCCTCACAATGCACGTGAAAGATGAAGTCAACTGGTATGTGATG
GGA
ATGGGCAATGAAATAGACCTGCACACTGTACACTTCCACGGCCACAGCTTCCAATACAAGCACAGGG
GA
GTATACAGTTCTGATGTCTTTGACCTTTTCCCTGGAACATACCAAACCCTAGAAATGTTTCCCCAAAC
A
CCTGGAACCTGGTTACTCCACTGCCACGTGACTGACCATGTCCATGCTGGGATGGCAACTACCTACACT
GTT
TTACCAGTAGAACAAGAGACTAAGTCTGGCTGA


Translation (1061 aa):
MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLISVDTEQSNFYLQNGPDRIGRKYKKA
L
YFEYTDGTFSKTIDKPAWLGFLGPVIKAEVEDKVYVHLKNLASRIYTFHAHGVTYTKEYE
GAVYPDNTT
D
FQRADDKVLPGQQYVYVLHANEPSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILCKK
GSLYKEKEK
N
IDQEFVLMFSVVDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRMY
SINGYTFGSLPGLSMCAADRV
K
WYLFGMGNEVDVHSAFFHGQALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNLNHLK
AGLQAF
F
QVRDCNKPSPEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTALE
SDSRVFFEQGATRIGGSYK
K
MAYREYTDGSFTNRKQRGPDEEHLGIL
GPVIWAEVGDTIKVTFHNKGQHPLSIQPMGVSFTAENEGTYY
G
PPGRSSQQ
AASHVAPKETFTYEWTVPKEMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSL
L
ADGRQ
KDVDKEFYLFPTVFDENESLLLDDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLN
M
CLGESIVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTK
GTFDVECLTTDHY
T
GGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQEQ
NVSNVFLDKEEFFI
G
SKYKKVVYRQFTDSSFREQVKRRAEDEHLGIL
GPPIHANVGDKVKVVFKNMATRPYSIHAHGVKTESST
V
VPTLP
GEVRTYTWQIPERSGAGREDSACIPWAYYSTVDRVKDLYSGLIGPLIVCRKSYVKVFSPKKKME
F
FLLFLVFDENESWYLDDNIKTYSEHPEKVNKDNEEFLESNKMH
AINGKMFGNLQGLTMHVKDEVNWYVM
G
MGNEIDLHTVHFHGHSFQYK
HRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATTYT
V
LPVEQ
ETKSG



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser