NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38135.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38135.1 Public Mus musculus 2 Lrp2 21 106 86 CCDS HistoryNCBI Gene:14725Re-query CCDS DB by CCDS ID:38135.1Re-query CCDS DB by GeneID:14725See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 38135.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000080953 ENSMUSP00000079752 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000080953Link to Ensembl Protein Viewer:ENSMUSP00000079752Re-query CCDS DB by Nucleotide ID:ENSMUST00000080953Re-query CCDS DB by Protein ID:ENSMUSP00000079752
Original member Current member EBI,WTSI OTTMUST00000031293 OTTMUSP00000014001 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000031293Link to Vega Protein Viewer:OTTMUSP00000014001Re-query CCDS DB by Nucleotide ID:OTTMUST00000031293Re-query CCDS DB by Protein ID:OTTMUSP00000014001
Original member Current member NCBI NM_001081088.1 NP_001074557.1 Accepted alive Link to Nucleotide Sequence:NM_001081088.1Link to Protein Sequence:NP_001074557.1Re-query CCDS DB by Nucleotide ID:NM_001081088Re-query CCDS DB by Protein ID:NP_001074557Link to BLink:NP_001074557.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074557.1 4660 A2ARV4 4660 100% 0 0

Chromosomal Locations for CCDS 38135.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 69425645 69425803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69425971 69426042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69428593 69428721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69430263 69430364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69431075 69431204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69431917 69432034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69432183 69432250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69433002 69433092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69435003 69435122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69436568 69436744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69437423 69437643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69438342 69438470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69439772 69439937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69441286 69441429 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69442746 69442877 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69443680 69443811 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69448115 69448243 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69451262 69451384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69453792 69453929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69454810 69454926 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69455460 69455576 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69456823 69456942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69458372 69458500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69459474 69459719 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69460341 69460537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69461257 69461434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69464574 69464797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69465589 69465759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69466205 69466357 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69466765 69467281 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69469373 69469668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69472346 69472547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69475380 69475511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69477010 69477132 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69478572 69478697 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69479099 69479341 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69480016 69480219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69481125 69481414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69482225 69482383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69482697 69482862 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69482993 69483913 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69486164 69486352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69487823 69488062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69489135 69489348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69491755 69491932 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69492352 69492461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69495671 69495814 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69496329 69496495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69499192 69499320 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69500610 69500787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69501487 69501715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69502478 69502662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69503387 69503598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69505081 69505329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69506379 69506756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69507765 69507881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69507968 69508087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69509133 69509378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69510343 69510624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69510930 69511067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69513247 69513377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69514137 69514262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69516391 69516583 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69518309 69518512 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69519914 69520054 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69521719 69521921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69523146 69523352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69523921 69524144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69525161 69525330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69527516 69527644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69533453 69533572 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69534909 69535058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69535985 69536101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69537515 69537628 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69537951 69538061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69548940 69549056 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69550830 69550952 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69552353 69552460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 69585815 69585893 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (13983 nt):
ATGGAGCGCGGGGCCGCGGCGGCGGCATGGATGCTGCTGCTGGCGATCGCTGCCTGCCTGGCGCCAGTCA
GT
GGCCAAGAATGTGGCAGTGGGAATTTTCGCTGTGACAACGGATACTGTATCCCTGCATCCTGGAGGTG
T
GATGGGACCAGAGACTGTTTGGATGACACTGATGAAATTGGCTGTCCTCCCAGGTCCTGCGGTTCAGGC
TTT
TTCCTGTGTCCTGCCGAAGGCACCTGCATCCCTAGCTCCTGGGTGTGTGACCAGGATAAGGATTGTT
CC
GATGGTGCAGATGAACAGCAAAATTGCCCTGGGACCACGTGCTCAAGCCAGCAGCTGACGTGCTCCAA
T
GGTCAGTGTGTTCCCATCGAGTACAGGTGTGACCATGTCAGTGACTGCCCCGATGGCTCTGACGAGAGA
AAC
TGCTATTATCCAACATGTGATCAACTTACTTGTGCCAACGGAGCCTGCTATAACACGAGTCAGAAGT
GT
GACCACAAAGTTGACTGCAGGGACTCCTCTGACGAAGCTAACTGCACTACGCTGTGTTCGCAAAAAGA
A
TTCCAATGTGGCAGTGGAGAGTGCATCCTTCGTGCCTATGTCTGTGACCATGACAATGACTGTGAAGAT
AAC
AGCGATGAGCACAATTGCAACTATGACACCTGCGGAGGCCACCAGTTCACTTGCTCCAATGGCCAGT
GC
ATTAACCAGAACTGGGTTTGTGATGGGGACGATGATTGCCAGGATTCTGGTGATGAGGATGGCTGTGA
A
AGTAACCAACGTCATCATACATGTTACCCAAGAGAATGGGCGTGTCCTGGGTCTGGACGATGCATCTCA
ATG
GATAAAGTTTGTGATGGAGTTCCCGACTGTCCAGAAGGAGAGGATGAGAACAATGCCACAAGTGGAC
GA
TACTGTGGTACGGGTCTCTGCTCTATCTTAAACTGTGAGTACCAATGCCATCAGACGCCATATGGAGG
A
GAATGCTTCTGCCCGCCAGGTCATATTATCAACAGCAATGACAGCCGTACTTGCATTGATTTCGATGAC
TGC
CAGATATGGGGAATTTGTGACCAGAAGTGTGAGAGCCGACAGGGCCGTCACCAGTGCCTCTGTGAAG
AA
GGTTATATCCTGGAGCGCGGGCAGCATTGCAAATCCAACGACTCCTTCAGTGCGGCCTCCATTATCTT
C
TCTAATGGTCGGGATTTGCTAGTTGGAGATCTTCATGGAAGAAACTTCCGGATTCTAGCAGAGTCTAAG
AAC
CGTGGAATAGTTATGGGAGTGGATTTTCACTATCAGAAGCACAGAGTTTTTTGGACAGACCCCATGC
AG
GCGAAGGTTTTTTCCACTGACATTAATGGCTTAAATACCCAAGAAATTCTTAATGTTTCTATTGATGC
T
CCAGAGAATCTGGCTGTGGATTGGATTAATAATAAACTTTATCTGGTAGAGACAAGAGTCAACCGCATT
GAT
GTGGTCAACTTGGAGGGAAATCAGCGTGTTACTCTCATAACTGAAAACTTGGGGCATCCTAGAGGAA
TT
GCCCTTGATCCAACTGTGGGCTATTTGTTTTTCTCAGATTGGGGAAGCCTCTCTGGGCAACCCAAGGT
G
GAGAGAGCCTTCATGGATGGTAGCAATCGGAAAGACCTGGTAACGACCAAATTGGGGTGGCCTGCTGGG
ATC
ACTCTGGATCTTGTATCCAAGCGAGTTTACTGGGTGGACTCTCGTTATGACTACATTGAAACTGTAA
CA
TATGATGGAATTCAAAGGAAGACGGTAGCGCGTGGAGGCTCCCTCGTCCCTCATCCGTTTGGAATAAG
C
TTATTTGAGGAGCACGTGTTCTTTACTGATTGGACAAAGATGGCGGTGATGAAGGCAAACAAGTTCACA
GAC
ACCAACCCTCAAGTGTACCACCAGTCTTCCCTGACGCCTTTCGGAGTGACAGTTTACCATGCCCTCA
GG
CAGCCCAATGCCACCAATCCGTGCGGAAACAACAATGGGGGCTGTGCGCAGATCTGTGTTCTTAGTCA
C
AGGACGGATAATGGCGGCCTGGGCTACCGGTGCAAGTGTGAATTTGGCTTTGAACTGGATGCAGATGAG
CAC
CACTGTGTTGCCGTTAAGAACTTCCTGCTCTTCTCATCACAAACGGCTGTGCGTGGGATCCCATTCA
CC
CTCTCCACCCAGGAAGATGTCATGGTTCCTGTTACAGGGAGTCCTTCCTTCTTTGTTGGAATTGACTT
T
GATGCTCAACACAGTACCATCTTCTACTCAGATTTGTCGAAAAACATAATTTATCAACAAAAAATTGAT
GGC
ACAGGAAAAGAAGTCATCACAGCAAACAGGTTGCAAAATGTTGAGTGTCTGTCCTTTGACTGGATCT
CA
AGGAATCTCTACTGGACAGATGGAGGGTCGAAGAGTGTCACTGTCATGAAGCTGGCTGATAAGTCCCG
A
CGACAGATAATCAGCAACTTAAACAACCCTCGATCCATTGTGGTGCATCCCGCTGCTGGGTATATGTTC
CTG
AGTGATTGGTTCCGTCCTGCAAAGATTATGAGAGCATGGAGCGATGGATCTCACCTAATGCCCATAG
TC
AACACTAGTCTGGGGTGGCCCAATGGCTTGGCCATCGATTGGAGTACTTCCCGGTTGTACTGGGTGGA
T
GCCTTTTTTGATAAGATTGAGCACAGCAACCTTGATGGTTTAGACAGGAAAAGACTGGGCCATGTTGAC
CAG
ATGACACATCCGTTTGGACTCACCGTTTTTAAAGATAACGTGTTCTTAACAGACTGGAGACTGGGTG
CG
ATTATTCGGGTCAGGAAGTCTGATGGTGGTGATATGACCGTTGTTCGACGTGGCATCAGCAGCATAAT
G
CACGTGAAAGCGTACGATGCTGACCTCCAGACCGGAACTAACTACTGCAGTCAGACCACCCATCCCAAC
GGC
GACTGCAGCCATTTCTGCTTCCCAGTTCCAAACTTCCAGCGGGTGTGTGGCTGCCCCTATGGAATGA
AG
CTTCAGAGGGACCAAATGACTTGTGAGGGAGACCCAGCCCGAGAGCCCCCCACACAGCAGTGTGGCTC
C
TCTTCCTTTCCCTGCAACAATGGCAAGTGTGTGCCCAGTATCTTCCGCTGTGATGGAGTGGATGATTGC
CAT
GACAACAGTGATGAGCATCAGTGTGGGGCACTTAATAACACCTGCTCATCTTCGGCTTTTACTTGTG
TC
CACGGTGGACAGTGCATCCCTGGCCAGTGGCGCTGTGACAAACAGAATGACTGTCTAGATGGCAGTGA
T
GAGCAAAACTGCCCCACTCGTTCACCGTCGTCTACTTGCCCGCCCACCTCCTTCACCTGCGACAATCAC
ATG
TGTATCCCCAAAGAGTGGGTCTGTGACACAGACAATGATTGTTCGGATGGATCAGATGAAAAGAACT
GT
CAAGCTTCGGGGACCTGCCACCCTACCCAGTTTCGCTGCCCTGACCACCGGTGTATCAGCCCACTGTA
T
GTCTGTGATGGGGACAAGGACTGTGTTGATGGCTCGGATGAGGCAGGCTGTGTGTTAAACTGCACAAGC
TCT
CAGTTCAAGTGTGCTGACGGGAGTTCTTGCATTAATAGCAGGTACCGCTGTGATGGGGTGTACGATT
GC
AAGGACAACTCTGATGAGGCGGGCTGTCCGACCAGGCCTCCTGGTATGTGCCACCCAGATGAGTTTCA
G
TGCCAGGGAGATGGTACCTGCATCCCTAACACCTGGGAGTGTGATGGGCACCCGGACTGTATCCAGGGC
TCG
GATGAACACAACGGCTGTGTTCCTAAGACCTGCTCCCCGTCTCATTTCCTCTGTGACAATGGAAACT
GC
ATCTACAACTCGTGGGTCTGTGATGGGGACAATGATTGCAGGGACATGAGTGATGAGAAGGACTGTCC
T
ACCCAGCCTTTTCACTGTCCTAGCTCACAGTGGCAGTGCCCAGGCTACAGCATCTGTGTCAATCTGAGC
GCC
CTGTGTGACGGCGTCTTTGACTGTCCCAATGGGACCGATGAGTCCCCGCTTTGCAATCAAGACAGCT
GC
TTACATTTTAATGGTGGCTGTACTCACCGGTGCATACAAGGGCCCTTTGGAGCCACCTGCGTGTGTCC
A
ATAGGATACCAACTTGCCAATGATACCAAGACCTGTGAAGATGTAAATGAGTGTGATATTCCAGGCTTT
TGC
AGCCAGCACTGTGTCAACATGAGAGGGTCCTTCCGGTGCGCTTGTGACCCAGAATATACATTGGAAA
GT
GATGGGCGGACTTGCAAAGTCACAGCATCTGAAAATCTGCTGTTAGTTGTAGCCAGTCGTGACAAAAT
C
ATTATGGACAATATCACTGCCCACACGCACAACATCTATTCTTTGGTCCAGGATGTTTCTTTTGTGGTT
GCT
CTGGATTTTGATTCAGTCACTGGTCGTGTCTTTTGGAGTGACTTATTGGAGGGTAAAACCTGGAGTG
CC
TTTCAAAACGGAACCGACAAGAGAGTGGTCCATGACAGTGGTCTCTCTTTGACAGAAATGATTGCAGT
A
GACTGGATAGGTCGCAACATTTACTGGACAGACTATACTCTTGAAACAATCGAAGTCTCTAAAATTGAT
GGA
AGTCACAGGACAGTACTGATCAGCAAAAATGTCACAAAACCTAGGGGACTCGCATTAGATCCTAGAA
TG
GGTGACAATGTAATGTTTTGGTCTGACTGGGGTCATCACCCTCGCATTGAGCGGGCCAGCATGGATGG
C
ACCATGCGCACAGTCATTGTCCAGGAAAAGATATACTGGCCCTGTGGCTTAAGTATTGACTACCCCAAT
CGC
CTCATCTACTTCATGGATGCCTATCTTGATTACATTGAATTCTGTGATTATGATGGACAGAACCGAA
GG
CAGGTCATTGCTAGCGATTTGGTTCTCCACCATCCGCACGCTCTTACTCTGTTTGAAGACTCTGTGTT
C
TGGACTGACCGCGGCACTCACCAGGTCATGCAGGCCAACAAGTGGCACGGGAGGAACCAATCTGTTGTA
ATG
TACAGCGTTCCCCAACCGCTCGGAATAATTGCCATCCATCCCTCCAGGCAACCATCTTCCCCGAATC
CA
TGTGCCTCTGCCACTTGCAGCCATCTTTGCCTGCTTTCTGCACAGGAGCCTAGACATTACTCTTGTGC
T
TGTCCCTCAGGGTGGAACCTTTCTGATGATTCTGTCAACTGTGTGAGAGGCGATCAACCTTTCTTGATA
TCC
GTAAGAGAAAATGTAATTTTTGGAATTTCCCTTGATCCTGAGGTGAAGAGCAACGATGCCATGGTCC
CC
ATATCGGGGATACAGCATGGTTATGATGTTGAATTTGATGACTCAGAGCAGTTCATCTATTGGGTTGA
G
AATCCAGGTGAAATTCACAGAGTGAAGACCGATGGCAGCAACAGGACAGCGTTTGCTCCTCTGTCTCTG
CTG
GGGTCTTCTTTGGGCCTGGCCTTAGACTGGGTATCAAGAAACATTTATTATACCACTCCTGCAAGTC
GG
TCCATTGAGGTGTTGACACTCCGGGGAGATACGAGGTATGGGAAAACCCTGATTACCAATGATGGCAC
C
CCGCTTGGTGTTGGTTTCCCGGTTGGCATAGCTGTTGATCCTGCACGTGGGAAACTGTATTGGTCAGAC
CAC
GGGACGGACAGTGGGGTTCCTGCCAAGATTGCAAGTGCTAACATGGATGGAACATCTTTAAAAATTC
TC
TTCACTGGGAACATGGAACATCTGGAGGTTGTCACCCTGGACATCCAGGAGCAAAAGCTCTACTGGGC
G
GTCACCAGCAGAGGCGTGATTGAAAGAGGAAATGTGGACGGTACAGAGAGGATGATCCTGGTGCACCAC
CTG
GCCCACCCGTGGGGTCTTGTGGTCCACGGCTCCTTCCTTTATTATTCCGATGAACAGTATGAGGTCA
TT
GAAAGAGTTGACAAGTCCTCTGGGAGTAACAAAGTCGTCTTCAGAGATAACATCCCATACCTGAGGGG
T
CTCCGGGTTTACCACCATCGCAATGCTGCTGACTCTTCCAATGGCTGTAGCAACAACCCAAATGCTTGC
CAG
CAGATCTGCCTGCCCGTACCAGGCGGAATGTTCTCCTGCGCCTGTGCCAGTGGGTTCAAGCTCAGCC
CC
GATGGTCGCTCCTGTTCTCCATATAACTCTTTCATAGTCGTTTCCATGCTGCCTGCAGTTAGAGGCTT
T
AGCTTGGAGTTGTCTGATCACTCAGAGGCCATGGTGCCAGTGGCTGGCCAAGGACGAAATGTTCTGCAT
GCG
GACGTGGATGTTGCCAATGGCTTTATTTACTGGTGTGATTTTAGCAGCTCTGTGAGATCCTCTAACG
GA
ATTCGTAGAATCAAACCCAACGGGTCTAATTTTACCAACATTGTTACCTACGGCATCGGGGCGAATGG
A
ATCCGGGGTGTGGCAGTGGATTGGGTAGCAGGAAATCTTTATTTCACCAATGCCTTTGTGTATGAGACA
CTG
ATAGAAGTGATACGGATCAATACCACATACCGCCGTGTCCTCCTCAAAGTCTCAGTGGATATGCCCA
GG
CATATCGTTGTTGACCCCAAGCACAGATATCTCTTCTGGGCCGACTACGGGCAGAAGCCGAAGATTGA
A
CGCTCTTTTCTTGACTGTACCAATAGAACTGTACTTGTTTCTGAAGGCATTGTCACCCCTCGGGGCCTG
GCA
GTGGACCATGACACTGGCTATATTTATTGGGTTGATGATTCCTTAGATATAATTGCCAGGATCCATC
GT
GACGGAGGAGAATCCCAAGTGGTTCGTTATGGCAGTCGTTACCCAACTCCTTATGGCATCACCGTCTT
T
GGAGAGTCGATCATTTGGGTGGATAGAAATTTGAGAAAAGTCTTCCAAGCCAGCAAGCAACCTGGGAAT
ACA
GACCCACCAACAGTGATAAGAGATAGTATCAACTTGCTACGGGATGTGACCATCTTTGATGAGCATG
TC
CAGCCCCTCTCACCGGCAGAGCTTAACAATAACCCTTGTTTGCAAAGCAATGGTGGGTGTTCCCACTT
T
TGCTTTGCCTTACCTGAGTTGCCTACCCCCAAATGTGGATGTGCTTTTGGGACTCTGGAAGATGATGGC
AAG
AACTGTGCTACTTCCCGAGAAGATTTCCTCATCTATTCCTTAAATAATTCCTTGAGAAGTTTACACT
TT
GACCCTCAAGACCATAACCTGCCTTTCCAAGCGATAAGTGTGGAAGGAATGGCCATCGCACTGGACTA
T
GACCGCAGAAATAATAGAATCTTCTTCACACAAAAGTTAAACCCTATCCGTGGCCAGATTTCCTATGTC
AAC
CTGTACTCAGGGGCCAGCTCTCCAACTATCCTGCTCTCAAATATAGGGGTTACTGATGGCATTGCCT
TT
GACTGGATAAATAGAAGAATTTATTACAGTGACTTTTCAAATCAGACAATAAATTCCATGGCTGAAGA
T
GGATCTAATCGCGCTGTGATCGCCCGTGTTTCCAAACCAAGAGCTATTGTATTAGATCCTTGCCGAGGG
TAC
ATGTATTGGACTGACTGGGGTACCAATGCCAAAATTGAAAGAGCCACACTGGGAGGGAACTTCCGGG
TC
CCCATTGTGAACACCAGCCTGGTTTGGCCCAATGGACTCACTCTGGACCTGGAGACCGACCTTCTCTA
C
TGGGCGGATGCTAGCCTGCAGAAAATAGAGCGCAGTACTCTCACGGGCTCCAACCGAGAAGTTGTCATC
AGC
ACTGCCTTCCATTCCTTTGGCTTAACTGTCTACGGCCAGTACATTTACTGGACAGACTTTTACACCA
AA
AAAATCTACCGTGCTAACAAGTACGATGGGTCAGACCTGATTGCAATGACCACTCGTTTGCCCACCCA
G
CCTAGTGGCATCTCCACAGTTGTCAAGACCCAGCAGCAGCAGTGTAGCAATCCTTGTGACCAGTTCAAT
GGA
GGATGCAGCCATATCTGTGCTCCAGGTCCAAACGGAGCTGAGTGCCAGTGTCCACACGAAGGCAGCT
GG
TATCTGGCCAACGATAACAAGTACTGTGTGGTGGACACAGGTGCCCGCTGTAATCAGTTCCAGTTCAC
C
TGCCTTAATGGGCGTTGTATCTCTCAGGATTGGAAATGTGACAATGACAACGACTGTGGTGATGGCAGT
GAT
GAGCTGCCCACAGTCTGTGCCTTTCACACGTGCCGATCAACAGCCTTCACTTGTGCCAATGGGCGAT
GT
GTGCCATACCATTATCGCTGTGATTTCTACAATGACTGCGGGGACAACAGCGATGAGGCAGGATGCCT
A
TTCAGGAGCTGCAACAGCACCACAGAGTTCACTTGCAGCAACGGGAGGTGTATACCTCTTAGTTATGTC
TGC
AATGGCATAAACAACTGCCATGACAATGACACCTCAGATGAGAAAAACTGCCCTCCCATCACTTGCC
AG
CCGGACTTCGCAAAATGCCAGACTACAAACATTTGTGTTCCCCGAGCTTTCTTGTGTGATGGAGACAA
T
GACTGTGGAGATGGGAGCGACGAGAACCCCATTTACTGCGCCTCACACACATGCCGCAGCAATGAGTTC
CAG
TGCGTCTCCCCCCACCGGTGTATCCCAAGCTATTGGTTCTGTGATGGGGAAGCCGACTGTGTGGATA
GC
TCGGATGAGCCTGACACTTGTGGGCATTCTCTAAACAGCTGCTCAGCCAATCAGTTCCACTGTGATAA
C
GGCAGGTGCATCTCAAGTAGCTGGGTCTGTGATGGTGATAATGACTGCGGAGACATGAGTGACGAGGAC
CAG
CGACATCACTGTGAGCTTCAGAACTGTTCCAGTACTGAGTTTACCTGTATAAACAGCAGACCTCCAA
AC
AGGAGGTGCATTCCACAACACTGGGTCTGTGACGGCGACGCAGACTGCGCGGATGCCCTCGACGAGCT
G
CAGAACTGCACCATGAGAGCGTGCTCTACGGGAGAGTTCAGCTGTGCAAATGGACGGTGTATCAGGCAG
TCA
TTCAGGTGTGATAGGCGCAACGACTGTGGGGACTACAGTGATGAGAGGGGCTGCTCGTACCCACCCT
GC
CGAGATGATCAATTTACTTGTCAGAACGGGCAATGTATCACTAAGCTCTATGTCTGTGATGAGGACAA
T
GACTGTGGAGATGGGTCGGATGAACAGGAGCACCTATGTCACACCCCAGAACCCACGTGCCCCCCTCAT
CAG
TTCCGGTGTGACAACGGGCACTGCATCGAGATGGGGACTGTCTGTAACCATGTGGATGACTGCTCAG
AC
AACAGTGATGAGAAAGGCTGTGGCATTAATGAGTGCCAGGATTCTTCAATCAGTCATTGTGACCACAA
C
TGTACAGATACCATAACCAGTTTCTACTGTTCCTGTCTTCCTGGGTACAAACTCATGTCTGACAAACGT
ACT
TGCGTGGATATTGACGAGTGCAAGGAGACACCCCAGCTCTGTAGCCAGAAGTGTGAGAATGTCATAG
GC
TCCTACATTTGTAAGTGTGCCCCTGGCTACATCCGTGAGCCAGATGGGAAGAGCTGCCGGCAGAATAG
C
AACATTGAGCCCTACCTCGTCTTCAGCAACCGTTATTATATAAGAAACTTAACTATAGATGGCACGTCA
TAC
TCTCTGATTTTGCAAGGATTGGGCAATGTTGTGGCCCTGGACTTTGATAGAGTAGAGGAGAGGCTGT
AT
TGGATCGATGCAGAGAAACAAATTATCGAGAGGATGTTTTTGAATAAGACAAACCAGGAGACCATCAT
A
AGCCACAGGTTAAGACGTGCTGAAAGTCTGGCTGTAGACTGGGTCAGCAGAAAACTCTATTGGTTGGAT
GCC
ATCCTAGATTGCCTGTTTGTCTCTGACCTTGAAGGTCGACAACGCAAAATGCTAGCCCAGCACTGTG
TG
GATGCAAACAATACCTTCTGTTTTGAAAATCCCAGGGGAATTGTCCTTCATCCTCAAAGAGGGTATGT
C
TACTGGGCAGATTGGGGTGATCATGCATACATTGCAAGAATTGGCATGGATGGAACCAATAAGACTGTG
ATT
ATCTCTACCAAGATCGAATGGCCCAATGCCATCACCATTGACTACACCAATGATCTCTTGTACTGGG
CA
GATGCTCACCTGGGTTACATCGAGTTCTCTGATTTGGAGGGTCACCATCGACACACAGTGTATGACGG
A
ACACTGCCCCACCCCTTTGCTCTCACCATTTTTGAAGACACTGTTTTTTGGACAGATTGGAATACACGG
ACA
GTTGAAAAGGGAAACAAATATGATGGATCAGGGCGAGTCGTGCTGGTGAACACAACCCACAAACCCT
TT
GACATCCACGTGTTACATCCATACCGGCAGCCGATTATGAGCAATCCCTGTGCTACCAACAACGGTGG
C
TGTTCTCACCTGTGCCTCATCAAAGCAGGAGGGAGAGGATTCACCTGCGAGTGTCCCGATGACTTCCAG
ACC
GTTCAGCTTCGAGACAGGACACTCTGTATGCCCATGTGCTCCAGCACGCAGTTCCTGTGTGGCAACA
AT
GAAAAGTGTATCCCTATCTGGTGGAAATGTGATGGACAGAAAGACTGCTCTGATGGTTCTGATGAATC
A
GACCTGTGTCCACACCGCTTCTGCCGTCTGGGACAGTTCCAGTGCCGAGATGGCAACTGCACGAGCCCC
CAG
GCTTTGTGCAATGCTCGCCAGGATTGTGCCGATGGCTCTGATGAAGACCGTGTTCTCTGTGAACATC
AC
CGGTGTGAAGCCAATGAGTGGCAGTGTGCCAACAAGCGTTGCATCCCTGAGTACTGGCAGTGTGACTC
C
GTGGACGACTGCCTGGATAATTCAGATGAAGACCCTTCGCACTGTGCCAGCCGGACCTGCAGGCCCGGC
CAG
TTCAAGTGTAACAATGGACGCTGCATCCCGCAGAGCTGGAAGTGTGACGTAGACAATGACTGTGGAG
AC
TATTCCGACGAGCCCATCCATGAATGCATGACTGCTGCTTACAACTGTGACAACCACACAGAATTCAG
C
TGCAAAACTAATTACCGCTGCATCCCGCAGTGGGCAGTGTGCAATGGTTTTGACGACTGCAGGGACAAC
AGT
GACGAGCAAGGCTGTGAATCGGTGCCGTGTCACCCTTCTGGGGATTTCCGGTGTGGAAATCACCACT
GC
ATCCCTCTCCGCTGGAAATGTGACGGCATTGATGACTGTGGAGACAACTCAGATGAGGAAAGTTGTGT
T
CCTCGGGAGTGCACAGAGAGCGAGTTTCGATGTGCTGATCAGCAATGCATCCCCTCTCGATGGGTCTGT
GAC
CAAGAAAATGACTGTGGAGACAACTCGGATGAACGGGACTGTGAGATGAAGACGTGCCATCCTGAAC
AT
TTTCAGTGTACGAGTGGACACTGTGTGCCCAAGGCGTTGGCATGCGATGGGAGAGCAGACTGTCTGGA
T
GCTTCTGATGAGTCCGCTTGCCCGACTCGCTTTCCCAATGGTACCTACTGCCCAGCTGCCATGTTCGAA
TGT
AAAAACCACGTGTGCATCCAGTCATTTTGGATATGTGATGGGGAAAATGACTGTGTCGACGGTTCTG
AT
GAGGAGATTCACCTGTGCTTCAATGTTCCATGTGAGTCACCACAGCGTTTCCGGTGTGATAACAGTCG
C
TGTATTTATGGCCACCAGCTGTGCAATGGTGTGGATGACTGTGGAGATGGAAGCGATGAGAAAGAAGAA
CAC
TGTAGAAAACCAACACACAAACCTTGCACAGACACCGAATACAAGTGCAGCAATGGGAACTGCGTCT
CG
CAGCACTATGTGTGTGATAATGTGGACGACTGTGGAGACCTTTCTGATGAAACTGGTTGCAATCTAGG
A
GAAAATAGAACATGTGCTGAAAAAATATGTGAACAGAACTGCACCCAGTTAAGCAATGGAGGATTTATC
TGC
TCCTGTCGACCTGGGTTCAAACCTAGTACTTTGGACAAAAATTCATGTCAAGACATCAATGAATGTG
AG
GAGTTTGGCATTTGCCCCCAAAGCTGCCGAAACAGCAAAGGAAGTTATGAATGTTTCTGTGTCGATGG
C
TTCAAGTCTATGAGTACCCACTATGGAGAACGGTGTGCAGCTGATGGAAGCCCTCCTCTCTTGCTCCTG
CCT
GAGAACGTCCGCATCCGGAAGTACAATATCTCCTCTGAGAAGTTCTCAGAGTATCTGGAAGAAGAGG
AA
CATATCCAAGCCATTGACTACGACTGGGACCCCGAGGGCATAGGCCTCAGTGTTGTATACTACACTGT
G
CTGTCACAGGGCTCTCAATTCGGTGCAATCAAACGTGCCTACCTTCCCGACTTTGAATCTGGTAGCAAC
AAT
CCCGTCCGTGAAGTTGACCTGGGCCTGAAATATTTAATGCAGCCAGATGGATTAGCCGTGGACTGGG
TT
GGAAGGCATATTTACTGGTCAGATGCTAAGAGTCAACGGATTGAGGTAGCTACCCTTGACGGAAGGTA
C
CGGAAGTGGCTGATCACCACCCAACTGGATCAACCAGCCGCCATTGCTGTGAATCCTAAGCTAGGGCTC
ATG
TTCTGGACTGACCAGGGAAAGCAGCCTAAAATTGAGTCTGCCTGGATGAATGGGGAGCACCGCAGTG
TT
CTGGCTTCTGCGAACCTTGGCTGGCCAAATGGTCTTTCCATAGATTACCTGAATGGTGATCGAATCTA
T
TGGAGTGACTCCAAAGAAGATGTTATTGAAAGCATAAAATACGATGGGACTGACAGGAGACTCATCATA
AAC
GATGCAATGAAGCCCTTCAGTCTGGACATCTTTGAAGACCAGCTCTACTGGGTAGCTAAGGAAAAGG
GA
GAAGTGTGGAGACAAAATAAATTTGGGAAAGGGAACAAAGAGAAATTGCTGGTGGTGAACCCCTGGCT
C
ACTCAAGTCCGCATCTTCCATCAACTGAGATACAACCAGTCAGTGTCCAACCCTTGCAAGCAGGTCTGT
AGC
CACCTCTGCCTGCTGAGACCAGGAGGCTACAGCTGTGCCTGTCCCCAAGGCTCCGACTTCGTAACTG
GC
AGCACCGTTGAGTGTGATGCAGCCAGTGAACTCCCCATCACCATGCCTTCCCCATGCAGGTGCATGCA
C
GGAGGAAGTTGCTATTTTGATGAGAATGACCTCCCCAAATGCAAGTGTTCTAGCGGCTACAGTGGAGAG
TAC
TGTGAGATTGGGCTCTCGAGAGGCATCCCTCCAGGGACGACAATGGCTCTTCTGTTGACATTCGCGA
TG
GTCATCATTGTTGGGGCTCTGGTACTCGTTGGATTCTTTCACTACAGGAAAACTGGCTCCCTTTTACC
C
TCTCTGCCCAAGCTGCCAAGCTTAAGCAGCCTTGCCAAACCCTCTGAAAATGGAAACGGGGTGACTTTC
AGA
TCAGGGGCTGATGTGAACATGGACATCGGTGTGTCTCCTTTTGGCCCTGAGACAATTATTGACAGAT
CC
ATGGCAATGAATGAACAATTCGTCATGGAGGTAGGCAAGCAGCCTGTGATATTTGAAAACCCAATGTA
T
GCAGCCAAAGACAGTACTTCCAAAGTGGGCCTGGCAGTGCAGGGACCGTCAGTAAGCTCACAGGTGACT
GTA
CCAGAAAATGTGGAAAACCAGAACTATGGAAGGTCCATAGATCCTTCTGAGATAGTTCCAGAGCCAA
AG
CCAGCCTCCCCTGGAGCTGATGAAACTCAGGGCACAAAATGGAATATCTTCAAACGAAAACCCAAGCA
G
ACAACGAACTTCGAAAATCCAATCTATGCAGAGATGGACACTGAGCAAAAGGAAGCTGTGGCTGTGGCT
CCC
CCTCCATCTCCTTCTCTTCCTGCTAAAGCTTCAAAAAGAAGTTCGACTCCAGGCTACACTGCCACAG
AA
GACACCTTTAAAGACACCGCAAACCTTGTGAAGGAAGACTCTGATGTATAG


Translation (4660 aa):
MERGAAAAAWMLLLAIAACLAPVSGQECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDEIGCPPRSCGSG
F
FLCPAEGTCIPSSWVCDQDKDCSDGADEQQNC
PGTTCSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDER
N
C
YYPTCDQLTCANGACYNTSQKCDHKVDCRDSSDEANCTTLCSQKEFQCGSGECILRAYVCDHDNDCED
N
SDEHNC
NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCIS
M
DKVCDGVPDCPEGEDENNATSGRYC
GTGLCSILNCEYQCHQTPYGGECFCPPGHIINSNDSRTCIDFDD
C
QIWGICDQKCESRQGRHQCLCEEGYILERGQHCKSNDS
FSAASIIFSNGRDLLVGDLHGRNFRILAESK
N
RGIVMGVDFHYQKHRVFWTDPMQAK
VFSTDINGLNTQEILNVSIDAPENLAVDWINNKLYLVETRVNRI
D
VVNLEGNQRVTLITENLGHPRGIALDPTV
GYLFFSDWGSLSGQPKVERAFMDGSNRKDLVTTKLGWPAG
I
TLDLVSKRVYWVDSRYDYIETVTYDGIQ
RKTVARGGSLVPHPFGISLFEEHVFFTDWTKMAVMKANKFT
D
TNPQVYHQSSLTPFGVTVYHALRQPN
ATNPCGNNNGGCAQICVLSHRTDNGGLGYRCKCEFGFELDADE
H
HCV
AVKNFLLFSSQTAVRGIPFTLSTQEDVMVPVTGSPSFFVGIDFDAQHSTIFYSDLSKNIIYQQKID
G
T
GKEVITANRLQNVECLSFDWISRNLYWTDGGSKSVTVMKLADKSRRQIISNLNNPRSIVVHPAAGYMF
L
SDWFRPAKIMRAWSDGSHLMPIVNTSLGWPNGLAIDW
STSRLYWVDAFFDKIEHSNLDGLDRKRLGHVD
Q
MTHPFGLTVFK
DNVFLTDWRLGAIIRVRKSDGGDMTVVRRGISSIMHVKAYDADLQTGTNYCSQTTHPN
G
DCSHFCFPVPNFQRVCGCPYGMKLQRDQMTCEGDPAREPPTQQCGSSSFPCNNGKCVPSIFRCDGVDDC
H
DNSDEHQCGAL
NNTCSSSAFTCVHGGQCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNH
M
CIPKEWVCDTDNDCSDGSDEKNC
QASGTCHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLNCTS
S
QFKCADGSSCINSRYRCDGVYDCKDNSDEAGC
PTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQG
S
DEHNGCVPKTCSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDCPTQPFHCPSSQWQCPGYSICVNLS
A
LCDGVFDCPNGTDESPLC
NQDSCLHFNGGCTHRCIQGPFGATCVCPIGYQLANDTKTCEDVNECDIPGF
C
SQHCVNMRGSFRCACDPEYTLESDGRTCKVT
ASENLLLVVASRDKIIMDNITAHTHNIYSLVQDVSFVV
A
LDFDSVTGRVFWSDLLEGKTWSAFQNGTDKRV
VHDSGLSLTEMIAVDWIGRNIYWTDYTLETIEVSKID
G
SHRTVLISKNVTKPRGLALDPRM
GDNVMFWSDWGHHPRIERASMDGTMRTVIVQEKIYWPCGLSIDYPN
R
LIYFMDAYLDYIEFCDYDGQNRRQVIASDL
VLHHPHALTLFEDSVFWTDRGTHQVMQANKWHGRNQSVV
M
YSVPQPLGIIAIHPSRQPS
SPNPCASATCSHLCLLSAQEPRHYSCACPSGWNLSDDSVNCVRGDQPFLI
S
VRENVIFGISLDPEVKSNDAMVPISGIQHGYDVEFDDSEQFIYWVENP
GEIHRVKTDGSNRTAFAPLSL
L
GSSLGLALDWVSRNIYYTTPASRSIE
VLTLRGDTRYGKTLITNDGTPLGVGFPVGIAVDPARGKLYWSD
H
GTDSGVPAKIASANMDGTSLKILFTGNMEHLEVVTLDIQEQKLYWAVTSRGV
IERGNVDGTERMILVHH
L
AHPWGLVVHGSFLYYSDEQYEVIERVDKSSGSNKVVFRDNIPYLRGLRVYHHR
NAADSSNGCSNNPNAC
Q
QICLPVPGGMFSCACASGFKLSPDGRSCSPYNSFIVVSMLPAVRGFSLELSDHSEAMVPVAGQ
GRNVLH
A
DVDVANGFIYWCDFSSSVRSSNGIRRIKPNGSNFTNIVTYGIGANGIRGVAVDWVA
GNLYFTNAFVYET
L
IEVIRINTTYRRVLLKVSVDMPRHIVVDPKHRYLFWADYGQKPKIERSFLDCTNRTVLVSEGIVTPRGL
A
VDHDTGYIYWVDDSLDIIARIHRDGGESQVVRYGS