NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37943.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37943.1 Public Mus musculus 19 Dock8 21 106 86 CCDS HistoryNCBI Gene:76088Re-query CCDS DB by CCDS ID:37943.1Re-query CCDS DB by GeneID:76088See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 37943.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025831 ENSMUSP00000025831 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025831Link to Ensembl Protein Viewer:ENSMUSP00000025831Re-query CCDS DB by Nucleotide ID:ENSMUST00000025831Re-query CCDS DB by Protein ID:ENSMUSP00000025831
Original member Current member NCBI NM_028785.3 NP_083061.2 Accepted alive Link to Nucleotide Sequence:NM_028785.3Link to Protein Sequence:NP_083061.2Re-query CCDS DB by Nucleotide ID:NM_028785Re-query CCDS DB by Protein ID:NP_083061Link to BLink:NP_083061.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083061.2 2100 Q8C147-1 2100 100% 0 0

Chromosomal Locations for CCDS 37943.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 24999651 24999703 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25051487 25051589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25061108 25061283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25065388 25065459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25078080 25078203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25079759 25079974 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25086180 25086265 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25087670 25087736 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25089891 25090040 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25094339 25094419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25095486 25095645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25097412 25097548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25099593 25099686 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25100852 25101014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25119412 25119529 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25121114 25121184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25122386 25122524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25123140 25123241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25127068 25127163 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25127476 25127710 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25130351 25130515 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25132064 25132236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25137317 25137412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25140069 25140164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25147295 25147444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25149783 25149896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25154145 25154300 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25155884 25156023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25158353 25158522 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25161016 25161155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25162941 25163123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25163448 25163577 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25164321 25164408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25169403 25169499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25171501 25171635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25172457 25172609 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25174174 25174332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25175360 25175460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25176828 25177020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25181562 25181705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25182961 25183092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25183489 25183623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25184851 25184940 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25188337 25188573 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25192187 25192330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25193409 25193515 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25200374 25200544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 25200987 25201047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6303 nt):
ATGGCCACGCTGCCGAGCGCCGAGCGCCGCGCCTTCGCGCTCAAGATCAACAGGTATTCATCGTCAGAAA
TA
AGGAAGCAGTTTACGCTCCCACCCAACCTCGGACAGTACCATCGGCACAGTATCAGTACATCTGGTTT
C
CCCTCTCTTCAGCTACCTCAGCTTTATGAGCCTGTCGAGCCAGTGGACTTTGAAGGACTCGTGATGACA
CAC
TTAAACAGCTTGGATGCAGAGCTGGCCCAGGAGCTGGGGGACCTCACCGATGACGACCTGCATGTGG
CC
TTCACACCCAAAGAATGTAGGACTTTGCAGCACTCTCTGCCAGAGGAAGGAGTTGAACTGGATCCTCA
C
GTCAGAGACTGTGTTCAGACCTATATTCGAGAGTGGCTGATTGTAAACCGGAAAAACCAAGGAAGTTCA
GAG
TTTTGCAGCTTTAAAAAGACGGGATCTCGCAGAGATTTTCAGAAGACGCTTCAGAAACAGACGTTTG
AG
TCAGAAACCTTGGAGTGCAGTGAACCGGACACTCAGACAGGACCCCGTCATCCCTTAAACGTGCTGTG
T
GACGTGTCTGGGAAGGGCCCCCTCACTTCTTGTGACTTCGACCTCCGCAGCCTGCAGCCTGATGAGCGG
CTG
GAAAACCTGCTCCAGCTTGTGAGCGCTGAGGACTTTGAGAAGGAGAAGGAGGAGGCCCGCAAGACCA
AT
CGGCCGGCTGAGCTCTTTGCCCTCTATCCGCCCGTGGATGAGGAGGATGCTGTGGAAATACGTCCAGT
A
CCTGAATGTCCTAAGGAACATCTGGGCAACAGAATATTGGTCAAGGTGCTGACTCTGAAGTTTGAGATT
GAA
ATTGAACCTCTGTTTGCCAGTATTGCCCTCTATGACGTTAAAGAAAGGAAAAAGATCTCAGAAAATT
TC
CACTGTGACCTGAACTCCGACCAGTTCAAAGGGTTTCTGCGAGCTCACACACCCTCGATTGACCCATC
G
AGTCAGGCTAGGTCTGCCGTGTTCTCTGTCACCTACCCATCTTCAGACATCTACCTGGTTGTCAAGATT
GAA
AAGGTCCTTCAGCAAGGAGAGATTGCAGACTGTGCAGAACCCTACATGATCATCAAAGAAAGCGATG
GT
GGAAAGAGTAAAGAAAAGGTTGAAAAACTAAAACTTCAAGCTGAATCCTTCTGCCAACGTTTGGGGAA
A
TACCGGATGCCCTTCGCCTGGGCCCCCATTAGCTTAGCAAGCTTCTTCAACATCTCCACCCTTGAAAGG
GAG
AGCACAGATGTGGAGCCTGGGGTTGGGAGGAACTCTGTGGGTGAGAAGAGGAGCTTGTCCCAATCCA
GG
AGGCCCTCTGAGCGAACCCTCTCCTTGGAGGAAAATGGAGTTGGATCCAACTTCAAAGCCACCACCTT
G
GCCACCAACATCTTCTTCAAACAGGAGGGAGATCGCCTTAGTGATGAAGACTTGTTCAAGTTTTTAGCT
GAC
TACAAGAGATCTTCATCCCTACAGCGAAGAGTCAAATCCATCCCAGGCTCACTGAGGCTGGAGATAT
CC
CCAGCTCCCGACGTGATGAACTGCTGCCTGACGCCCGAGATGCTGCCAGTCAAACCTTTTCCTGAAAA
T
CGGACGCGTCCACACAAGGAGATTTTGGAATTTCCGATCCGGGAGGTGTACGTCCCTCACACTGTGTAC
AG
A
AACCTTCTGTACGTATACCCCCAGCGACTGAACTTCGCTAGCAAGCTAGCATCTGCCCGGAACATCA
CA
ATAAAGATTCAGTTTATGTGCGGAGAAGACCCCAGCAATGCTATGCCGGTCATCTTTGGCAAGTCCAG
T
GGGCCTGAATTTCTGCAGGAAGTATATACAGCTATTACATACCATAATAAGTCTCCTGACTTTTACGAA
GAA
GTGAAAATTAAGCTCCCTGCCAAGCTCACAGTGAATCATCACCTCCTCTTCACCTTCTACCACATCA
GC
TGTCAGCAGAAGCAAGGGGCCTCCGGAGAAAGCCTTCTGGGGTACTCGTGGCTGCCGATTCTGTTAAA
C
GAACGTCTTCAAACCGGATCCTACTGTCTGCCTGTTGCCTTGGAAAAACTACCACCCAACTACTCCATA
CAT
TCTGCTGAGAAAGTCCCTTTACAGAATCCTCCCATTAAGTGGGCCGAGGGCCATAAGGGGGTATTTA
AT
ATTGAAGTGCAAGCTGTTTCTTCCGTCCACACCCAGGATAACCACCTGGAGAAGTTCTTCACCCTTTG
C
CACTCCCTGGAGAGCCAGGTGAGCTTCCCTATCCGTGTGCTGGACCAGAAGATCACCGAGAGCACGCTG
GAG
CACGAGCTGAAACTCAGCATCATCTGCCTCAACTCCTCCCGCCTGGAGCCCCTCGTGCTCTTCCTCC
AC
CTGGTGCTTGACAAGCTGTTCCAGCTTTCCGTGCAGCCCATGGTCATTGCTGGCCAAACAGCAAACTT
C
TCCCAGTTTGCCTTCGAGTCTGTGGTGGCCATTGCCAATAGCCTGCACAACAGCAAGGACCTGAGGAAG
GAC
CAGCACGGGAGGAACTGCCTTCTGGCCTCCTACGTGCACTACGTGTTCCGGCTGCCGGAACTGCACA
GG
GATACATCCAAGTCAGGTGGCCCCACCACCGTAGTCCCCGACCCCCGATACCACACATATGGACGCAC
A
TCTGCCGCTGCAGTGAGTTCAAAGCTGATGCAGGCCCGTGTGATGAGCAGCAGCAACCCAGACCTGACT
GGG
TCACACTGTGCAGCCGATGAGGAAGTTAAGAACATCATGTCTTCAAAGATTGCCGATCGCAACTGCA
GC
CGGATGTCTTACTATTGCTCTGGCAATAGTGATGCGCCAGGTTCAACTGCAGCCCCAAGACCAGTCAG
C
AAAAAGCATTTCCATGAGGAGCTTGCCCTGCAGATGGTGGTCAGCACTGGAGTAGTGAGAGAAACGGTC
TTC
AAGTACGCCTGGTTCTTCTTTGAGCTTCTGGTGAAAAGCATGGCACAGTATGTCCATAACCTGGATA
AA
CGGGACAGTTTTCGGAGGACTCGTTTTTCTGACCGCTTCAAAGATGACATAACTACCATTGTTAATGT
G
GTCACCTCGGAGATAGCAGCCCTTTTAGTGAAACCTCAGAAGGAAAGCGAGCAGGCAGAAAAGATCAAC
ATC
AGCCTTGCCTTCTTCCTGTATGACCTCCTGTCAATCATGGACAGAGGCTTCGTGTTCAACCTCATCA
AG
CATTACTGCAGCCAGCTGTCAGCCAAGCTGAATATCCTTCCAACGCTCATCTCCATGCGGCTGGAATT
C
CTGAGGATCCTCTGCAGCCATGAGCACTACCTCAACTTGAACCTCCTCTTCATGAATACCGACACCGCA
CCA
GCATCTCCCTGCCCCTCCATATCCTCCCAGAACTCGAGTTCCTGCTCCAGTTTCCAGGACCAAAAGA
TT
GCCAGCATGTTCGATCTGACCCCGGAGTACCGGCAGCAGCACTTCCTTACAGGGCTGCTCTTCACGGA
G
CTGGCTGTTGCCCTGGATGCTGAGGGGGATGGAATTAGCAGAGTACAGAGAAAAGCCGTGAGTGCCATC
CAC
AGCCTTCTGTGTTCTCACGACCTGGATCCACGGTGTCGCAAACCGGAAGTGAAAGTCAAAATCGCCG
CC
CTTTACCTGCCGTTGGTCGGCATCATTCTGGACGCTCTGCCACAGCTCTATGACTTTACAGATGCTCG
C
AGTGGAAGGAGTCGTGCCAGTGGCTCGTATGAAGAACAAGATGTGGCCAACGGAATCAACCAGAATGTG
GCC
CTGGCCATAGCGGGGAATCACTTTAATTTGAAGACCAGTGGAGCAATGCTGTCTTCCTTGCCCTATA
AG
CAGTACAACATGCTGAATGCAGACACCACCCGCCACCTCATGATTTGCTTCCTGTGGATCATGAAAAA
T
GCTGATCAGAGCCTCATCAGGAAGTGGATCGCTGACCTGCCTTCCATGCAGCTCAATAGGATTCTGGAC
CTG
CTGTTCATCTGTGTCTCCTGCTTTGAATACAAGGGAAAGCAGAGTTCTGACAAAGTCAGTAACCAGG
TC
CTGCAGAAGTCAAGAGACGTCAAGGCCAAGCTGGAAGAGGCCCTGCTCCGTGGGGAAGGAGCCCGTGG
G
GAGATGATGCGCCGTCGCATTCCAGGGACTGACCGGTTTCCAGGCATAAATGAAAATCTGAGATGGAGG
AAA
GAGCAGACACAGTGGCGGCAGGCTAATGAGAAGCTGGACAAAACAAAGGCAGAGTTAGATCAAGAAG
CC
TTGATCAGTGGCAACCTGGCTACAGAAGCTAATTTGATCATCCTGGATATGCAGGAGAACATCATCCA
G
GCAAGCTCCGCCCTGGACTGTAAAGACAGCCTGCTGGGAGGTGTCCTCCGGGTCCTGGTGAATTCTCTG
AGC
TGTGACCAGAGCACCACCTACCTGACTCACTGTTTCGCAACCCTCCGAGCCCTCATCGCCAAGTTTG
GA
GACCTGCTGTTCGAGGAGGAGATGGAGCAGTGTGCTGACCTGTGTCAGCGGGTGCTACATCACTGCAG
C
AGCAGCATGGACGTCACACGGAGCCAAGCCTGCGCCACCCTCTACCTCCTCATGCGGTTCAGCTTCGGA
GCC
ACCAGTAACTTTGCAAGGGTAAAGATGCAAGTGACCATGGCACTGGCATCCCTGGTAGGCAAAGCAC
CA
GACTTCAACGAAGAGCACCTGAGAAGGTCCTTAAGGACAATTTTGGCCTATTCAGAAGAGGACACGGC
C
ATGCAGACAACTCCTTTTCCCATGCAGGTGGAGGAACTTCTCTGCAATCTGAACAGCATTCTGTACGAC
ACA
GTGAAGATGAGGGAATTCCAGGAAGACCCTGAGATGCTTATGGACCTCATGTACAGAATTGCCAAGA
GC
TACCAGGCATCGCCTGACCTGCGGCTGACTTGGCTCCAGAACATGGCAGAGAAACACACTAAGAAGAA
G
TGCTTCACAGAGGCCGCCATGTGCCTGGTGCATGCAGCCGCCCTGGTGGCCGAGTACCTGAGCATGCTG
GAG
GACCACAGCTACCTGCCGGTGGGCAGCGTCAGCTTTCAGAATATTTCTTCCAATGTGCTTGAGGAGT
CT
GCAGTCTCTGATGACACCTTGTCACCTGATGAGGACGGCGTATGCTCTGGTCGGTACTTCACTGAGAG
T
GGCCTGGTGGGCCTCCTGGAGCAGGCTGCGGAGCTCTTCAGCACGGGAGGCTTGTACGAGACGGTTAAT
GAA
GTCTACAAGCTGGTCATCCCTATCCTGGAGGCACACAGAGATTTCCGGAAGCTGACCTCCACTCACG
AC
AAGCTGCAGAAGGCCTTCGATAACATCATCAACAAGGACCATAAGAGGATGTTTGGGACCTACTTCCG
A
GTTGGTTTCTACGGATCCCGATTTGGGGATTTGGATGAGCAGGAGTTCGTGTACAAGGAACCCGCAATC
ACG
AAGCTCCCGGAGATCTCACATAGACTAGAGGGATTTTATGGCCAGTGTTTCGGTGCAGAGTTTGTGG
AA
GTGATAAAAGACTCTACTCCAGTGGACAAAACCAAGTTGGATCCTAACAAGGCCTACATTCAGATCAC
T
TTTGTGGAGCCTTACTTTGATGAATATGAGATGAAAGACCGGGTGACCTACTTCGAGAAGAATTTCAAC
CTC
CGGAGGTTCATGTACACCACCCCCTTCACCCTGGAGGGGAGACCCCGGGGCGAGCTTCATGAGCAAC
AC
CGCAGAAACACCGTGCTCACCACCATGCACGCCTTCCCCTACATCAAGACCAGGATCCGAGTCAGCCA
G
AAAGAGGAGTTCGTTTTGACTCCGATTGAGGTTGCCATTGAAGATATGAAGAAGAAGACCCTGCAGTTA
GCC
GTGGCCACTCACCAGGAGCCCCCTGATGCAAAGATGCTGCAAATGGTACTGCAGGGCTCTGTAGGAG
CC
ACTGTAAATCAGGGACCACTGGAGGTGGCCCAAGTGTTCTTGGCTGAAATTCCAGCTGACCCAAAGCT
C
TACCGACATCACAACAAGCTGAGGTTGTGCTTCAAGGAGTTCATAATGCGATGCGGAGAGGCCGTGGAG
AAG
AACAGGCGACTCATCACCGCAGAGCAGCGGGAGTACCAGCAGGAGCTGAAGAAGAACTACAACAAGC
TG
AGAGACAGCCTCAGGCCCATGATTGAGCGGAAAATCCCAGAGCTCTACAAGCCCATATTCAGAGTTGA
C
AGTCAGAAGAGGGACTCTTTCCACAGATCTAGTTTCAGGAAATGTGAAACCCAGTTGTCACAGGGCAGC
TGA


Translation (2100 aa):
MATLPSAERRAFALKINRYSSSEIRKQFTLPPNLGQYHRHSISTSGFPSLQLPQLYEPVEPVDFEGLVMT
H
LNSLDAELAQELGDLTDDDLHVAFTPKECRTLQHSLPEE
GVELDPHVRDCVQTYIREWLIVNRKNQGSS
E
FCSFKKTGSRRDFQKTLQKQTFESETLECSEPDTQ
TGPRHPLNVLCDVSGKGPLTSCDFDLRSLQPDER
L
ENLLQLVSAEDFEKEKEEARKTNRPAELFALYPPVDE
EDAVEIRPVPECPKEHLGNRILVKVLTLKFEI
E
IEPLFASIALYDVKERKK
ISENFHCDLNSDQFKGFLRAHTPSIDPSSQARSAVFSVTYPSSDIYLVVKI
E
KVLQQGEIADCAEPYMIIKESDGGK
SKEKVEKLKLQAESFCQRLGKYRMPFAWAPISLASFFNISTLER
E
STDVEPGV
GRNSVGEKRSLSQSRRPSERTLSLEENGVGSNFKATTLATNIFFKQEGDRLSDEDLFKFLA
D
YKRSSSLQRRVKSIP
GSLRLEISPAPDVMNCCLTPEMLPVKPFPENRTRPHKEILEFPIREVYVPHTVY
R
NLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYE
E
VKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYS
WLPILLNERLQTGSYCLPVALEKLPPNYSI
H
SAE
KVPLQNPPIKWAEGHKGVFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVSFPIRVLDQKITESTL
E
HELKLSIICLNSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQT
ANFSQFAFESVVAIANSLHNSKDLRK
D
QHGRNCLLASYVHYVFRLPELHRDTSKS
GGPTTVVPDPRYHTYGRTSAAAVSSKLMQARVMSSSNPDLT
G
SHCAADEEVKNIMSSK
IADRNCSRMSYYCSGNSDAPGSTAAPRPVSKKHFHEELALQMVVSTGVVRETV
F
KYAWFFFELL
VKSMAQYVHNLDKRDSFRRTRFSDRFKDDITTIVNVVTSEIAALLVKPQKESEQAEKIN
I
SLAFFLYDLLSIMDRGFVFNLIKHYCSQ
LSAKLNILPTLISMRLEFLRILCSHEHYLNLNLLFMNTDTA
P
ASPCPSISSQ
NSSSCSSFQDQKIASMFDLTPEYRQQHFLTGLLFTELAVALDAEGDGISRVQRKAVSAI
H
SLLCSHDLDPRCRKPEVKVKIAALYLPLVGIILDALPQLYDFT
DARSGRSRASGSYEEQDVANGINQNV
A
LAIAGNHFNLKTSGAMLSSL
PYKQYNMLNADTTRHLMICFLWIMKNADQSLIRKWIADLPSMQLNRILD
L
LFICVSCFEYK
GKQSSDKVSNQVLQKSRDVKAKLEEALLRGEGARGEMMRRRIPGTDRFPGINENLRWR
K
EQTQWRQANEKLD
KTKAELDQEALISGNLATEANLIILDMQENIIQASSALDCKDSLLGGVLRVLVNSL
S
CDQSTTYLTHCFATLRALIAK
FGDLLFEEEMEQCADLCQRVLHHCSSSMDVTRSQACATLYLLMRFSFG
A
TS
NFARVKMQVTMALASLVGKAPDFNEEHLRRSLRTILAYSEEDTAMQTTPFPMQVEELLCNLNSILYD
T
VKMREFQEDPEMLMDLMY
RIAKSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSML
E
DHSYLPVGSVSFQ
NISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVN
E
VYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINK
DHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAI
T
KLPEISHRLE
GFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFN
L
RRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEE
FVLTPIEVAIEDMKKKTLQL
A
VATHQEPPDAKMLQMVLQGSVGATVNQ
GPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVE
K
NRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIPELYKPIFRVDSQK
RDSFHRSSFRKCETQLSQGS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser