NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37380.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37380.1 Public Mus musculus 16 Tmprss15 21 106 86 CCDS HistoryNCBI Gene:19146Re-query CCDS DB by CCDS ID:37380.1Re-query CCDS DB by GeneID:19146See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37380.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060402 ENSMUSP00000052034 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060402Link to Ensembl Protein Viewer:ENSMUSP00000052034Re-query CCDS DB by Nucleotide ID:ENSMUST00000060402Re-query CCDS DB by Protein ID:ENSMUSP00000052034
Original member Current member EBI,WTSI OTTMUST00000062327 OTTMUSP00000030709 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000062327Link to Vega Protein Viewer:OTTMUSP00000030709Re-query CCDS DB by Nucleotide ID:OTTMUST00000062327Re-query CCDS DB by Protein ID:OTTMUSP00000030709
Original member Current member NCBI NM_178855.4 NP_849186.2 Accepted alive Link to Nucleotide Sequence:NM_178855.4Link to Protein Sequence:NP_849186.2Re-query CCDS DB by Nucleotide ID:NM_178855Re-query CCDS DB by Protein ID:NP_849186Link to BLAST:NP_849186.2

Chromosomal Locations for CCDS 37380.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 78953800 78953955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78957310 78957452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78960540 78960635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78962014 78962195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78967938 78968124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78968267 78968316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78972180 78972275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78985875 78986007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 78987644 78987754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79001737 79001877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79003324 79003449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79006130 79006219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79021387 79021522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79024289 79024439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79024754 79024859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79034205 79034354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79035111 79035251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79054034 79054140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79057611 79057719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79062137 79062268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79071401 79071445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79073177 79073212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79075776 79075820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79078949 79079100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79087449 79087516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79087763 79087893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 79090773 79090917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3165 nt):
ATGAAATCCAGCAGAGACGAGGCTGTAGGACATCACTCTATCAGCTCTTTTGAAGTGATGCTCTCAGCTC
TC
TTCATTATGCTCATGGTCTTCTCTATTGGATTAATTGCAGTGTCCTGGCTTGCAGTCAAGGAATCTGA
A
GGAGATGCAGCCCTGGGGAAAAGTCATGAAGTCAGAGGGACATTTAAAATAACATCTGGAGTGACATAT
AAT
CCTAATTTACAAGACAAACACTCTGTGGATTTCAAAGTTCTTGCTTTTGACCTTCAGCAAATGATAG
AC
GAGATCTTTGAATCAAGTAGTCTGAAGAATGAATATGAAAAATCGAAGGTTTTTCAATTTGAAAAAGG
C
AGCGTTATTGTCCTCTTTGACCTCTTTTTTGCTCAGTGGGTGTCAGATAAAAATGTAAAAGAAGAACTG
ATT
CAGGGCATTGAAGCAAATATATCCAGCCAACTGGTCACTCTCCATATTGATTTGAACAGCATTGATA
TC
ACAGCATCCTTGAGTGACTTCACAACAGCAGTCCCTGTAACAACTTCAGATAAGCTAACAACCAGCAG
T
CCTATGACAACTTCAGCATCACTGGGTAACTTATCAACAACAGTGGCTGCAACAACTTCAGGCCATGTC
TCA
ATAGAGTGCCAGCCTGGTTCACGGCCCTGTGCTCATGCTTGGAACTGTGTAGCAACTGATTTGTTTT
GT
GATGGAGAAGTGAACTGTCCAGATGGTTCAGATGAAGACACTGGGCTATGTGCCACAGCTTGTGATGG
A
AGATTTTTGTTGACTGGAGATTCTGGGGTTTTCCAAGCTGATCGTTATCCAAGGCCAGATGAATCAGGT
GTT
GTTTGCCGATGGATCATCCGTGTAAACCAAGGACTTTCCATTAGAATGAACTTTGGATCTTTTATTC
CA
CATTATACAGATGTGTTAGATATCTATGAAGGTATAGGACCTAGCAAAATTTTAAGAGGCTCCTTTTG
G
GAAACTGATCCTGGAACAATTCGAATTTTTTCCAACCTAGTTACTGTCACCTTTCTGATAAAATCAGAT
GAA
TATGATTACATTGGTTTTAATGCAACGTACAGCACTTTCAACAACAGCGAACTTAACAATTATGAGA
AA
ATCGACTGTACATTTGATGATGGATTTTGCTTCTGGACCCAGGATCTTGATGATGATAATGAGTGGGA
A
AGAATCCAAGTGACCACGTTTCCTTGCTACACTGGCCCACGTTTTGACCACACATATGGGAATGGCTCA
G
GA
TTTTACATTTCTACACCAACTGAACAGGGATGGAGAAGCGAAAGAGTAGGCCTTTCAAGCCTCTCTT
TA
GACCTCACTTCAGAGCCTGTCTGCCTTCATTTTTGGTATTACATGTGCTGTGAAAATGTCTACAATTT
A
AACATTCATATCAGCAGTGCTGAAACCACAGACAAGATAGTTTTTCAAAGGAAAGGAAACTATGGGAGG
AAC
TGGAATTATGGTCAAGTCACATTAAATGAAACAGGAGAATTTAAGGTTGTGTTCAATGCTTTCAGAA
AC
CGAGGTTGCAGTACAATAGCCCTGGATGATATAAGCCTAACAAATGGAATTTGTAGTCAGAGTCCTTA
T
CCAGAACCAACCTTGGTTCCCACCCCTCCACCAGAGCTTCCAACTGACTGCGGAGGACCTTTTGAACTA
TGG
GAGCCAAATTCAACCTTCAGTTCTCCGAACTTTCCAGACAAATATCCCAATCAAGCTTCCTGTATAT
GG
AATTTAAATGCACAGAGAGGGAAAAATATTCAACTTCATTTTCAAGAATTCGATTTAGAAAACATCAA
T
GATGTGGTGGAAGTTAGAGATGGGGGAGAATTTGACTCCCTGCTCCTAGCTGTGTACACAGGACCTGGT
CCT
GTGAAGGACTTGTTCTCTACCACCAATAGGATGACTGTGATTTTCACCACAAACATGGAGACCAGAC
GC
AAGGGCTTCAAAGCAAATTTCACTTCCGGCTATTACTTGGGGATTCCAGAGCCCTGCCAAGATGACGA
A
TTTCAGTGCAAAGATGGAAACTGCATTCCTCTGGGGAATCTCTGTGATAGCTACCCGCACTGTAGAGAT
GGC
TCAGATGAAGCAAGCTGTGTGCGTTTTCTTAATGGCACAAGAAGCAACAATGGGTTGGTACAGTTCA
AT
ATCCATAGCATATGGCATATAGCTTGTGCTGAGAACTGGACCACACAAATTTCAAATGAAGTTTGTCA
T
CTTCTGGGACTAGGGAGTGCAAACTCATCAATGCCAATATCATCTACCGGAGGTGGACCATTTGTGAGA
GTA
AACCAAGCCCCTAATGGAAGCTTGATACTAACTCCTAGTCTACAATGCTCCCAAGATTCCTTGATTC
TA
TTGCAATGCAACCATAAATCATGTGGAGAAAAAAAGGTGACTCAGAAAGTCAGCCCAAAGATCGTTGG
T
GGAAGTGACGCCCAGGCAGGGGCCTGGCCCTGGGTTGTGGCTTTGTATCACAGAGACAGGTCTACAGAC
CGT
CTGCTCTGCGGTGCATCTCTTGTCAGCAGTGACTGGCTGGTGTCAGCTGCACACTGTGTGTATAGAA
GA
AATCTAGATCCAACCAGATGGACAGCAGTCCTGGGCCTGCATATGCAATCAAATCTGACTTCTCCTCA
A
GTAGTAAGACGGGTGGTTGATCAAATTGTCATAAACCCTCATTATGACAGACGCAGAAAGGTCAACGAC
ATC
GCTATGATGCACCTTGAGTTTAAAGTAAATTACACAGATTATATACAGCCTATTTGTTTACCAGAAG
AG
AATCAAATATTTATTCCAGGAAGAACTTGTTCGATTGCTGGCTGGGGATATGATAAAATAAATGCAGG
T
TCTACTGTTGATGTGCTGAAAGAAGCTGATGTTCCTCTTATATCCAATGAAAAGTGCCAGCAACAGCTG
CCA
GAATACAACATCACTGAAAGTATGATATGTGCAGGATATGAAGAAGGAGGAATAGATTCTTGTCAGG
GT
GATTCTGGAGGGCCATTAATGTGCCAAGAAAACAACAGATGGTTTCTTGTTGGTGTGACATCATTTGG
A
GTCCAGTGTGCACTGCCTAATCACCCTGGGGTATATGTCCGAGTCTCACAGTTTATAGAATGGATCCAT
AGC
TTTCTACATTAG


Translation (1054 aa):
MKSSRDEAVGHHSISSFEVMLSALFIMLMVFSIGLIAVSWLAVKESEGDAALGKSHEVRGTFKITSGVTY
N
PNLQDKHSVDFKVLAFDLQQM
IDEIFESSSLKNEYEKSKVFQFEKGSVIVLFDLFFAQWVSDKNVKEEL
I
QGIEANISSQLVTLHIDLNSIDIT
ASLSDFTTAVPVTTSDKLTTSSPMTTSASLGNLSTTVAATTSGHV
S
IECQPGSRPCAHAWNCVATDLFCDGEVNCPDGSDEDTGLC
ATACDGRFLLTGDSGVFQADRYPRPDESG
V
VCRWII
RVNQGLSIRMNFGSFIPHYTDVLDIYEGIGPSKILRGSFWETDPGTIRIFSNLVTVTFLIKSD
E
YDYIGFNATYSTFNNSELN
NYEKIDCTFDDGFCFWTQDLDDDNEWERIQVTTFPCYTGPRFDHTYGNGS
G
FYISTPTEQGWRSERVGLSSLSLDLTSEPVCLHFWYYMCCENVYNLNIHISSAETTDKIVFQRKGNYGR
N
WNYGQVTLNETGEFK
VVFNAFRNRGCSTIALDDISLTNGICSQSPYPEPTLVPTPPPELPTDCGGPFEL
W
EPNSTFSSPNFPDKYPNQAS
CIWNLNAQRGKNIQLHFQEFDLENINDVVEVRDGGEFDSLLLAVYTGPG
P
VKDLFSTTNRMTVIFTTNMETRRKGFKANFTSGYYLGIP
EPCQDDEFQCKDGNCIPLGNLCDSYPHCRD
G
SDEASC
VRFLNGTRSNNGLVQFNIHSIWHIACAENWTTQISNEVCHLLGLGSANSSMPISSTGGGPFVR
V
NQAPNGSLILTP
SLQCSQDSLILLQCNHKSCGEKKVTQKVSPKIVGGSDAQAGAWPWVVALYHRDRSTD
R
LLCGASLVSSDWLVSAAHCVY
RRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVND
I
AMMHLEFKVNYT
DYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQL
P
EYNITESMICAGYEEGGIDSCQ
GDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIH
S
FLH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser