NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37358.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37358.1 Public Mus musculus 16 Impg2 21 106 86 CCDS HistoryNCBI Gene:224224Re-query CCDS DB by CCDS ID:37358.1Re-query CCDS DB by GeneID:224224See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37358.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000069936 ENSMUSP00000063648 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000069936Link to Ensembl Protein Viewer:ENSMUSP00000063648Re-query CCDS DB by Nucleotide ID:ENSMUST00000069936Re-query CCDS DB by Protein ID:ENSMUSP00000063648
Original member Current member EBI,WTSI OTTMUST00000082141 OTTMUSP00000044018 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000082141Link to Vega Protein Viewer:OTTMUSP00000044018Re-query CCDS DB by Nucleotide ID:OTTMUST00000082141Re-query CCDS DB by Protein ID:OTTMUSP00000044018
Original member Current member NCBI NM_174876.3 NP_777365.2 Accepted alive Link to Nucleotide Sequence:NM_174876.3Link to Protein Sequence:NP_777365.2Re-query CCDS DB by Nucleotide ID:NM_174876Re-query CCDS DB by Protein ID:NP_777365Link to BLAST:NP_777365.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_777365.2 1243 Q80XH2-1 1243 100% 0 0

Chromosomal Locations for CCDS 37358.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 56204532 56204616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56205092 56205319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56218314 56218480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56221381 56221412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56221507 56221530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56224338 56224387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56225727 56225794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56231391 56231552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56236705 56236763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56243609 56243629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56252103 56252347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56254163 56254248 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56257904 56258213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56259372 56260645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56261518 56261737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56264963 56265173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56267062 56267250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56268217 56268424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56269006 56269085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 56270780 56270792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3732 nt):
ATGATTATGTTTCTCCCTGTGGGGAGGATGTCTCTGGGCATTTTGATACTTTTCCTGACAGGAGGAAACC
TT
GTATCAGCCTCAGAAGAGAGACAAGAACCCATGCATGCCGTCTCTGTCCTCTCACCTGAGAAGTCAAC
A
GACCTTTCCCTGCCTACCAGGAAGAGGCAGCTTTTGGATGCCACGGAGACTGGGAGGAGGTGGCTGCTT
AGA
AGGCGGCGATCTATTCTGTTCCCAAATGGAGTAAAAATTTGCTCCAGTGAAACCGTTGCAGAGGCTG
TG
GCAAACCATGTGAAGTATTTTAAAGCCCGAGTGTGCCAGGAAGCCATCTGGGAAGCCTTCAGGACGTT
T
TGGGATCGACTTCCTGGGCGTGATGAATATCGTCACTGGATGAATTTATGTGAGGATGGAGTCACAAGT
GTA
TTTGAAATGGGCGCCCATTTTAGTCAGTCTGTGGAACATAGAAACCTAATCATGAAGAAACTGGCTT
AC
ACAAGGGAAGCTGAGAGCAGCTCCTGCAAGGATCAGTCCTGTGGGCCTGAGTTGTCCTTTCCAGTTCC
T
ATTGGTGAGACCTCAACACTGACAGGTGCTGTCTCCAGTGCTTCCTATCCAGGGTTGGCTTCGGAGAGC
AGC
GCAGCGTCACCGCAGGAGAGTATCAGCAATGAAATTGAGAATGTGACAGAGGAGCCCACACAACCAG
CT
GCTGAACAGATTGCGGAATTCAGCATCCAACTTCTGGGGAAGCGATACAGTGAAGAACTGCGGGATCC
C
TCCAGCGCCCTCTACCGGCTCCTCGTGGAAGAGTTTATTTCAGAGGTTGAAAAAGCATTCACAGGGTTA
CCT
GGCTACAAGGGCATCCGTGTTCTGGAATTCAGGGCCCCGGAGGAAAATGACAGTGGGATAGATGTTC
AC
TATGCAGTTACCTTCAATGGCGAAGCCATCAGCAATACCACCTGGGACCTCATAAGCCTTCACTCCAA
C
AAGGTAGAAAACCATGGCCTTGTAGAGATGGATGATAAACCCACTGCTGTCTATACAATTAGTAACTTC
AGA
GATTATATCGCTGAGACGCTGCACCAGAACTTTTTGATGGGAAATTCCTCTTTGAATCCAGATCCCA
AG
TCTCTCCAGCTCATCAATGTGAGAGGAGTTTTGCTCCCCCAAACAGAAGACATAGTTTGGAACACCCA
A
AGTTCAAGTCTTCAGGTGACAACATCCTCTATTTTGGATAATACCCTTCAAGCTGAATGGCTCTCAGCA
GAT
ACCACCACCACCACCACCACCACCATTTCACCATTTGGTTTCAGCTCCAGTTCTCCCTCAGCCACTG
GC
AGGGAACTCCAGTCACAAAGTGCTTTGCGTGACGTAGTGTCTACCTCCAAGTTAGCTTCTCCCACGAA
G
GTGGTCCTCAGTTCTCTCCCAGAGATTTTAGGGGGTAGCAGCTTGACTCTTCATTCTGTTACCCCAGCA
GTG
CTTCAGCCTGACCTGCCTGTGGCTCCTGAGGGAAGGACTTCTGGATCGTTCATATTAGAAGATGGGT
TA
GCCAGCACTGAAGAATTAGAAGATACTTCTATTGATGGATTGCCTTCAAGCCCATTAATTCAACCTGT
G
CCAAAAGAAACAGTACCACCTATGGAAGACTCTGACACGGCTCTCTTGTCCACACCACATCTGACCTCT
TCT
GCTATAGAAGACCTTACTAAAGACATAGGGACACCTTCTGGCTTGGAGTCCTTGGCTTCCAACATCT
CA
GACCAGTTGGAAGTGATCCCATGGTTTCCAGACACCTCTGTGGAAAAAGACTTCATTTTTGAAAGTGG
C
TTGGGTTCTGGGTCTGGGAAAGATGTAGATGTGATTGATTGGCCATGGAGTGAGACTTCATTAGAGAAG
ACC
ACTAAACCACTGTCAAAGTCATGGTCTGAAGAACAGGATGCACTATTACCAACTGAGGGTAGAGAAA
AA
TTACATATAGATGGCAGAGTAGATTCCACAGAACAAATTATTGAATCATCAGAACATAGATATGGAGA
T
AGGCCCATACATTTTATAGAGGAAGAATCCCATGTTAGATCTACTATACCCATCTTTGTAGAGTCCGCA
ACT
CCACCTACATCTCCAATCTTTTCAAAACACACTTCAGATGTACCAGACATTGATTCTTACTCACTTA
CC
AAACCACCCTTCTTACCGGTAACTATAGCAATCCCTGCTTCCACTAAGAAAACAGATGAGGTACTCAA
G
GAAGATATGGTACATACAGAATCATCCAGTCACAAAGAACTTGACAGTGAGGTTCCAGTGTCAAGGCCA
GAT
ATGCAGCCTGTGTGGACCATGTTGCCAGAATCAGATACAGTTTGGACAAGAACTTCTTCCTTAGGGA
AA
TTGTCCAGAGACACATTGGCAAGTACACCAGAGAGCACTGACAGACTCTGGTTGAAAGCTTCCATGAC
A
CAGTCCACTGAATTGCCTTCAACCACCCACTCCACCCAGCTAGAGGAGGAAGTAATAATGGCGGTCCAG
GAT
ATTTCATTAGAACTAGATCAGGTAGGCACAGATTATTATCAGTCCGAGCTAACTGAAGAACAACATG
GC
AAGGCTGACAGCTATGTGGAAATGTCTACCAGTGTTCACTACACAGAGATGCCTATTGTGGCTCTGCC
C
ACAAAAGGAGGTGTCTTGAGTCACACCCAGACTGCAGGAGCATTGGTGGTTTTCTTCAGCCTCCGCGTG
ACA
AACATGTTGTTTTCAGAAGACTTGTTTAACAAAAACTCTTTGGAATATAAAGCCCTGGAACAAAGAT
TC
TTAGAACTGCTGGTTCCCTATCTCCAGTCAAATCTGTCAGGGTTCCAGAACCTAGAAATCCTGAGTTT
C
AGAAACGGCAGCATTGTGGTGAACAGCCGAGTGAGGTTCGCCGAGTCTGCCCCTCCTAATGTCAACAAG
GCC
ATGTATAGGATTCTGGAAGACTTTTGTACCACTGCCTACCAAACCATGAACTTGGATATCGATAAGT
AC
TCCCTGGACGTGGAATCAGGTGATGAGGCCAACCCTTGCAAGTTTCAGGCCTGTAATGAATTTTCTGA
G
TGTTTGGTAAATCCATGGAGTGGAGAAGCAAAGTGCAAATGCTACCCTGGGTACCTGAGTGTGGATGAA
CTG
CCTTGTCAAAGTCTCTGTGATCTACAGCCTGACTTCTGCTTGAACGATGGAAAGTGTGACATTATGC
CT
GGGCATGGAGCCATTTGTAGATGCCGGGTTGGTTCAAACTGGTGGTATCGAGGCCAACACTGTGAGGA
G
TTTGTGTCTGAGCCCTTTGTCATAGGCATCACTATAGCCTCTGTGGTTAGCTTTCTCCTTGTTGCTTCT
GCT
GTCGTCTTCTTCCTTGTGAAGATGCTTCAAGCTCAGAATGTCAGGAGAGAAAGGCAGAGGCCCACCA
G
C
TCCAGCAGGCACCCTGACAGTCTGTCATCTGTTGAGAATGCTATGAAGTATAACCCTGCATATGAGAG
C
CACTTGGCTGGATGTGAACTGTATGAGAAATCCTATAGCCAACATCCCTTCTATAGCTCTGCTAGTGAA
GAG
GTGATTGGTGGTCTGAGCAGAGAAGAAATCAGACAGATGTATGAAAGTAGCGACCTTTCCAAAGAGG
AA
ATTCAAGAGAGAATGAGGATTTTGGAACTCTATGCTAATGATCCTGAGTTTGCAGCTTTTGTGAGAGA
G
CATCAAATGGAGGAGCTTTAA


Translation (1243 aa):
MIMFLPVGRMSLGILILFLTGGNLVSASEERQEPMHAVSVLSPEKSTDLSLPTRKRQLLDATETGRRWLL
R
RRRSILFPNGVKICSSETVAEAVANHVKYFKAR
VCQEAIWEAFRTFWDRLPGRDEYRHWMNLCEDGVTS
V
FEMGAHFSQSVEHRNLIMK
KLAYTREAESSSCKDQSCGPELSFPVPIGETSTLTGAVSSASYPGLASES
S
AASPQES
ISNEIENVTEEPTQPAAEQIAEFSIQLLGKRYSEELRDPSSALYRLLVEEFISEVEKAFTGL
P
GYKGIRVLEF
RAPEENDSGIDVHYAVTFNGEAISNTTWDLISLHSNKVENHGLVEMDDKPTAVYTISNF
R
DYIAETLHQNFLMGNSSLNPDPKSLQLIN
VRGVLLPQTEDIVWNTQSSSLQVTTSSILDNTLQAEWLSA
D
TTTTTTTTISPFGFSSSSPSATGRELQSQSALRDVVSTSKLASPTKVVLSSLPEILGGSSLTLHSVTPA
V
LQPDLPVAPEGRTSGSFILED
GLASTEELEDTSIDGLPSSPLIQPVPKETVPPMEDSDTALLSTPHLTS
S
AIEDLTKDIGTPSGLESLASNISDQLEVIPWFPDTSVEKDFIFESGLGSGSGKDVDVIDWPWSETSLEK
T
TKPLSKSWSEEQDALLPTEGREKLHIDGRVDSTEQIIESSEHRYGDRPIHFIEEESHVRSTIPIFVESA
T
PPTSPIFSKHTSDVPDIDSYSLTKPPFLPVTIAIPASTKKTDEVLKEDMVHTESSSHKELDSEVPVSRP
D
MQPVWTMLPESDTVWTRTSSLGKLSRDTLASTPESTDRLWLKASMTQSTELPSTTHSTQLEEEVIMAVQ
D
ISLELDQVGTDYYQSELTEEQHGKADSYVEMSTSVHYTEMPIVALPTKGGVLSHTQTAGALVVFFSLRV
T
NMLFSEDLFNKNSLEYKALEQRFLEL
LVPYLQSNLSGFQNLEILSFRNGSIVVNSRVRFAESAPPNVNK
A
MYRILEDFCTTAYQTMNLDIDKYSLDVES
GDEANPCKFQACNEFSECLVNPWSGEAKCKCYPGYLSVDE
L
PCQSLCDLQPDFCLNDGKCDIMPGHGAIC
RCRVGSNWWYRGQHCEEFVSEPFVIGITIASVVSFLLVAS
A
VVFFLVKMLQAQNVRRERQRPT
SSSRHPDSLSSVENAMKYNPAYESHLAGCELYEKSYSQHPFYSSASE
E
VIGGLSREEIRQMYESSDLSKE
EIQERMRILELYANDPEFAAFVREHQMEEL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser