NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37196.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37196.1 Public Mus musculus 15 Tuba1a 21 106 86 CCDS HistoryNCBI Gene:22142Re-query CCDS DB by CCDS ID:37196.1Re-query CCDS DB by GeneID:22142See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 37196.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000097014 ENSMUSP00000094778 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000097014Link to Ensembl Protein Viewer:ENSMUSP00000094778Re-query CCDS DB by Nucleotide ID:ENSMUST00000097014Re-query CCDS DB by Protein ID:ENSMUSP00000094778
Original member Current member EBI,WTSI OTTMUST00000041305 OTTMUSP00000018539 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041305Link to Vega Protein Viewer:OTTMUSP00000018539Re-query CCDS DB by Nucleotide ID:OTTMUST00000041305Re-query CCDS DB by Protein ID:OTTMUSP00000018539
Original member Current member NCBI NM_011653.2 NP_035783.1 Accepted alive Link to Nucleotide Sequence:NM_011653.2Link to Protein Sequence:NP_035783.1Re-query CCDS DB by Nucleotide ID:NM_011653Re-query CCDS DB by Protein ID:NP_035783Link to BLAST:NP_035783.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035783.1 451 P68369 451 100% 0 0

Chromosomal Locations for CCDS 37196.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 98950034 98951014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98951188 98951336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98951469 98951691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 98953451 98953453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1356 nt):
ATGCGTGAGTGCATCTCCATCCATGTTGGCCAGGCTGGTGTCCAGATCGGCAATGCCTGCTGGGAGCTCT
AC
TGCCTGGAACATGGCATCCAGCCTGATGGCCAGATGCCAAGTGACAAGACCATTGGGGGAGGAGATGA
C
TCCTTCAACACCTTCTTCAGTGAGACAGGAGCTGGCAAGCATGTGCCCCGGGCAGTGTTCGTAGACCTG
GAA
CCCACGGTCATCGATGAAGTTCGCACCGGCACCTACCGCCAGCTCTTCCACCCTGAGCAGCTCATCA
CA
GGCAAGGAGGATGCTGCCAATAACTATGCTCGTGGCCACTACACCATTGGCAAGGAGATCATTGACCT
T
GTCCTGGACAGGATTCGCAAGCTGGCTGACCAGTGCACAGGTCTCCAGGGCTTCTTGGTTTTCCACAGC
TTT
GGCGGGGGAACTGGCTCTGGCTTCACCTCCCTGCTGATGGAGCGGCTCTCTGTGGATTACGGAAAGA
AG
TCCAAGCTGGAGTTCTCCATTTACCCAGCCCCCCAGGTTTCCACTGCTGTGGTTGAGCCCTACAATTC
C
ATCCTCACCACCCACACCACCCTGGAGCACTCTGATTGTGCCTTCATGGTAGACAATGAGGCCATCTAT
GAT
ATCTGTCGTAGAAACCTCGACATTGAGCGCCCAACCTACACTAACCTAAACAGGTTGATAGGTCAAA
TT
GTGTCTTCCATCACTGCTTCCCTCAGATTTGATGGGGCCCTGAATGTTGATCTGACAGAATTCCAGAC
C
AACCTGGTACCCTACCCTCGTATCCACTTCCCTCTGGCCACTTATGCCCCTGTCATCTCTGCTGAGAAA
GCC
TACCACGAGCAGCTTTCTGTAGCAGAGATCACCAATGCCTGCTTTGAGCCAGCCAACCAGATGGTGA
AA
TGTGACCCTCGCCATGGTAAATACATGGCTTGCTGCCTGCTGTACCGTGGTGATGTGGTTCCCAAAGA
T
GTCAATGCTGCCATTGCCACCATCAAGACCAAGCGTACCATCCAGTTTGTGGACTGGTGCCCCACTGGC
TTC
AAGGTTGGCATTAACTACCAGCCTCCCACTGTGGTACCCGGTGGTGACCTGGCCAAGGTGCAGAGAG
CT
GTGTGCATGCTGAGCAACACCACAGCCATTGCTGAGGCCTGGGCTCGCCTAGATCACAAGTTTGATCT
G
ATGTATGCCAAGCGTGCCTTTGTGCACTGGTATGTGGGTGAGGGCATGGAGGAGGGTGAGTTCTCTGAG
GCC
CGTGAGGACATGGCTGCCCTAGAGAAGGATTATGAGGAGGTTGGTGTGGATTCTGTGGAAGGCGAGG
GG
GAGGAAGAAGGAGAGGAATACTAA


Translation (451 aa):
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL
E
PTVI
DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS
F
GGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
D
ICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK
A
YHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTG
F
KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
A
REDMAALEKDYEEVGVDSVEGEGEEEGEEY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser