NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37095.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37095.1 Public Mus musculus 15 Trappc9 21 106 86 CCDS HistoryNCBI Gene:76510Re-query CCDS DB by CCDS ID:37095.1Re-query CCDS DB by GeneID:76510See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 37095.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000089770 ENSMUSP00000087202 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000089770Link to Ensembl Protein Viewer:ENSMUSP00000087202Re-query CCDS DB by Nucleotide ID:ENSMUST00000089770Re-query CCDS DB by Protein ID:ENSMUSP00000087202
Original member Current member NCBI NM_180662.2 NP_850993.2 Accepted alive Link to Nucleotide Sequence:NM_180662.2Link to Protein Sequence:NP_850993.2Re-query CCDS DB by Nucleotide ID:NM_180662Re-query CCDS DB by Protein ID:NP_850993Link to BLAST:NP_850993.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_850993.2 1139 Q3U0M1-2 1139 100% 0 0

Chromosomal Locations for CCDS 37095.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 72589995 72590162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72590616 72590839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72685283 72685373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72693504 72693657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72736776 72736886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72757216 72757358 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72903557 72903681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72925506 72925658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72936962 72937125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72941860 72941992 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72946059 72946185 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72948790 72948875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72952974 72953119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72963560 72963686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 72999972 73000115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 73012806 73013022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 73025962 73026087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 73031522 73031643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 73050595 73050723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 73052162 73052307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 73057922 73058505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3420 nt):
ATGAGCGTCCCCGACTACATGCAGTGCGCAGAGGATCACCAGACCCTTCTGGTGGTCGTCCAGGCCGTGG
GC
ATCGTCTCTGAGGAGAACTTCTTCAGGATCTACAAGCGGATCTGCTCCGTGAGCCAGCTCAGTGTGCG
C
GACACGCAGCGTGCCCTCTTCATCCGCTATCGGCACCACTACCCGCCCGAGAACAACGAGTGGGGCGAC
TTC
CAGACGCACCGCAAGGTGGTAGGCCTCATCACCATCACCGATTGCTTCTCGCCCAAAGACTGGCCAC
AG
ACCTTCGAGAAGTTCCACGTGCAGAAGGAGATCTACGGTTCCACGCTCTACGATTCCCGCCTCTTCGT
G
TTCGGGCTGCAGGGTGATGTGGCTGAGCAGCCGCGCCCGGATGTGGCCTTCTATCCCAACTACGATGAC
TGC
GATTCAGTGGAGAAGCGCATCGAAGACTTCATCGAGTCCCTTTTCATTGTGTTGGAGTCCAAGCGCC
TG
GACAGAGCCACCGACAAATCCGGGGACAAGATCCCTCTTCTCTGTGTCCCCTTCGAGAAGAAGGACTT
C
GTGGGACTAGACACGGATAGCAGACACTACAAGAAGCGGTGCCAAGGACGCATGCGGAAACACGTTGGG
GAC
TTGTGCCTCCAGGCTGGGATGCTGCAGGACGCCCTGGTACACTACCACATGTCCGTGGAGCTCCTGC
GC
TCAGTGAATGACTTCCTGTGGTTAGGGGCTGCCCTGGAGGGGTTGTGCTCGGCTTCAGTCATTTATCA
T
TATCCCGGAGGAACTGGTGGCAAGACTGGGGCTCGGAGACTCCAAGGCAGCTCACTTCCCTCAGAAGCA
GCC
AACAGACACCGGCCAGGTGCTCTCACCACCAACGGCATAAATCCTGACACCAGCACTGAGATCGGAA
GG
GCCAAGAATTGCCTCAGCCCCGAGGACATCATTGACAAATACAAAGAGGCCATCTCCTATTACAGCAA
G
TACAAGAACGCCGGAGTGATTGAGCTGGAAGCCTGTGTCAAGGCCGTGCGCGTCCTAGCGATTCAGAAG
CGT
GGCATGGAGGCTTCGGAGTTTCTTCAGAATGCTGTGTACATCAATCTCCGGCAGCTTTCGGAAGAAG
AG
AAAATCCAGCGCTACAGCATCCTGTCTGAGCTCTACGAGCTGATTGGCTTCCACCGCAAGTCAGCATT
C
TTCAAGCGAGTGGCTGCCATGCAGTGTGTGGCGCCAAGCATTGCAGAACCTGGCTGGAGGGCCTGTTAC
AAG
CTCCTTTTGGAGACGCTGCCTGGCTACAGTCTGTCGCTAGATCCCAAGGACTTCAGCAAAGGCACAC
AC
CGAGGCTGGGCTGCCGTTCAGATGCGTCTGCTGCATGAGCTGGTCTATGCCTCCCGCAGGATGGGGAA
C
CCCGCACTGTCCGTGCGGCACCTCTCCTTCCTCTTGCAGACCATGCTGGACTTCCTGTCTGACCAGGAA
AAG
AAAGATGTGACTCAAAGCCTGGAGAACTACACTGCCAAGTGTCCCGGGACGATGGAGCCCATCACCC
TC
CCAGATGGTCTCACACTGCCTCCCGTGCCGTTTACCAAGTTGCCCATTGTCAGGTGCGTGAAGCTGCT
G
AGTCTCCCCACCAGCCTGCGACCCCACAAGGTGAAAAGCTTGCTGGGCCAGAGCATGTCCACCAAGAGC
CCC
TTCATCTATTCGCCAATCATCGCACATAACCGTGGAGAAGAACGCAACAAAAAAATAGATTTCCAGT
GG
GTTCAAGGAGATGTGTGTGAAGTTCAGCTGATGGTGTACAACCCAATGCCGTTTGAGCTCCGCGTGGA
A
AACATGGGGCTTCTCACCAGCGGAGTGGAGTTTGAGTCTCTTCCTGCAGCGCTTTCCCTCCCTGCGGAA
TCT
GGTTTGTACCCGGTGACGCTGGTCGGAGTCCCACAGACTACAGGAATGATCACTGTGAATGGTTACC
AT
ACCACAGTCTTTGGGGTCTTCAGCGACTGCCTTCTGGACAACCTTCCGGGACTGAAGACGGGCGGCTC
C
ACCGTGGAAGTCATCCCTGCCTTGCCAAGACTGCAGATCAGCACATCGCTGCCCAGGTCCGCACGCTCA
CTG
CAGCCTTCTGCCGGCGATGAGATCGCCACCAACGTATCTGTTCAGCTGTACAACGGAGAAACCCAGC
AG
CTGGCTGTCACCTTGGAGAACATCGGACTGGAGCCTCTGGAGCAGCTGGAGGTCACCTCAAAGCTTCT
C
ACCACCAAGGAAAAGTTGTATGGCGACTTCTTGAGCTGGAAACTGGAAGAGACGCTGGCCCAGTTTCCC
CTG
CAGCCCGGGAAGGTGGCTACTTTCACCATCAACATCAAGGCAAAGCTGGATTTCTCTTGCCAGGAGA
AT
CTTCTCCAGGACCTGAGTGATGATGGAATCAGCGTGAGCGGCTTTCCCCTGTCCAGTCCTTTCCGCCA
G
GTGGTGCGGCCCCGAGTGGAGAGCAGACCCACAAACCCTTCTGAGGGCAGCAAGACGGGGGACCTTGGC
CAC
GTCAAGACTCTGGAAGCTGTCCTGAACTTCAAGTACTCTGGAGGCCCAGGCCACGTGGAAGGGTATT
AC
AGGAACCTCTCCCTGGGACTACACGTGGAAGTCGAGCCTTCTGTGTTTTTTACCCGAGTCAGCACACT
T
CCAGCAACCAGCACCCGGCAGTGCCACTTGCTCCTTGATGTCTTCAACTCCACAGAGCACGAGCTGACA
GTC
TGCGCCAGGAACAACTCTGAACTTGTCCTGCATGCCAGTGAGTGCCAGCGAATGGCTATTCAAGTGG
AC
AAGTTCAACTTTGAAAGTGTCCCAGAATCCCCCGGAGAGAAGGGACACTTTGCAAATCTGAAGCAGCT
G
GAAGAAGAGAGACAGGAGGCACGAGGCCTGGAGATCAGCAGCAAGCTGGACATCCGCTGGAGAATTCCT
TCT
CTGAAGCGCAGTGGTGAGGCGAGCGTGGAGGGCCTCCTGAACCAGCTCATCCTGGAACACCTGCAGC
TG
GCACCTCTGCAGTGGGATGTGCTAGTGGATGGGCAGCCATGTGACTGTGAGGTGGCAGCTGCCTGCCA
G
GTCGGTGACCCCGTGCGCTTGGAGGTGCGGCTGACTAACAGGAGTCCCCGAAGTGTGGGGCCCTTTGCC
CTC
ACCGTGGTCCCTTTCCAGGACCACCAGAACGGTGTGCACAACTATGACCTGCATGATGTCATCTCCT
TT
GTGGGTTCCAGTACCTTCTACCTTGACACGGTACAACCATCAGGCCAATCCACCTGCCTTGGGGCCCT
C
CTCTTCCTCTACACAGGTGACTTCTTCCTCAACATCCGGTTCCACGAGGACTGCAAGAGCAAGGAGCTG
CCA
CCCTCCTGGGTTTGCTTACCCAGCGTGCATGTGAGGGCCCTCGGGGCACAGGCCTGA


Translation (1139 aa):
MSVPDYMQCAEDHQTLLVVVQAVGIVSEENFFRIYKRICSVSQLSVRDTQRALFIRYRHHYPPENNEWGD
F
QTHRKVVGLITITDCFSPKDWPQTFEKFHVQKEIYGSTLYDSRLFVFGLQGDVAEQPRPDVAFYPNYDD
C
DSVEKRIEDFIESLFIVLESKRLDRATDKSGDKIPLLCVPFEKKDFVGLDTDS
RHYKKRCQGRMRKHVG
D
LCLQAGMLQDALVHYHMSVELLRSVNDFLWLG
AALEGLCSASVIYHYPGGTGGKTGARRLQGSSLPSEA
A
NRHRP
GALTTNGINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSKYKNAGVIELEACVKAVRVLAIQK
R
GMEASEFLQNAVYINLRQ
LSEEEKIQRYSILSELYELIGFHRKSAFFKRVAAMQCVAPSIAEPGWRACY
K
LLLETLPGYSLSLDPKDFSK
GTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSFLLQTMLDFLSDQE
K
KDVTQSLENYTAKCPGTMEPITLPDGLTLPPVPFTKLPIV
RCVKLLSLPTSLRPHKVKSLLGQSMSTKS
P
FIYSPIIAHNRGEERNKKI
DFQWVQGDVCEVQLMVYNPMPFELRVENMGLLTSGVEFESLPAALSLPAE
S
GLYPVTLVGVPQTTGMITVN
GYHTTVFGVFSDCLLDNLPGLKTGGSTVEVIPALPRLQISTSLPRSARS
L
QPSAGDEIATNVSVQLYNGETQQLAVTLENIGLEPLEQLEVTSKLLTTK
EKLYGDFLSWKLEETLAQFP
L
QPGKVATFTINIKAKLDFSCQENLLQDLSD
DGISVSGFPLSSPFRQVVRPRVESRPTNPSEGSKTGDLG
H
VK
TLEAVLNFKYSGGPGHVEGYYRNLSLGLHVEVEPSVFFTRVSTLPATSTRQCHLLLDVFNSTEHELT
V
CARNNSELVLHASECQ
RMAIQVDKFNFESVPESPGEKGHFANLKQLEEERQEARGLEISSKLDIRWRIP
S
LKRSGEASVEGLLNQLILEHLQLAPLQW
DVLVDGQPCDCEVAAACQVGDPVRLEVRLTNRSPRSVGPFA
L
TVVPFQDHQNGVHNYDLHDVISFVGSSTFYLDT
VQPSGQSTCLGALLFLYTGDFFLNIRFHEDCKSKEL
P
PSWVCLPSVHVRALGAQA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser