NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36922.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36922.1 Public Mus musculus 14 Mmp14 21 106 86 CCDS HistoryNCBI Gene:17387Re-query CCDS DB by CCDS ID:36922.1Re-query CCDS DB by GeneID:17387See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36922.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000089688 ENSMUSP00000087119 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000089688Link to Ensembl Protein Viewer:ENSMUSP00000087119Re-query CCDS DB by Nucleotide ID:ENSMUST00000089688Re-query CCDS DB by Protein ID:ENSMUSP00000087119
Original member Current member EBI,WTSI OTTMUST00000134095 OTTMUSP00000071180 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000134095Link to Vega Protein Viewer:OTTMUSP00000071180Re-query CCDS DB by Nucleotide ID:OTTMUST00000134095Re-query CCDS DB by Protein ID:OTTMUSP00000071180
Original member Current member NCBI NM_008608.4 NP_032634.3 Accepted alive Link to Nucleotide Sequence:NM_008608.4Link to Protein Sequence:NP_032634.3Re-query CCDS DB by Nucleotide ID:NM_008608Re-query CCDS DB by Protein ID:NP_032634Link to BLAST:NP_032634.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032634.3 582 P53690 582 100% 0 0

Chromosomal Locations for CCDS 36922.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 54431866 54431973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54435745 54435893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54436138 54436260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54436615 54436922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54437601 54437762 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54438665 54438825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54439011 54439149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54439281 54439431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54439905 54440020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 54440341 54440672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1749 nt):
ATGTCTCCCGCCCCTCGACCCTCCCGCAGCCTCCTGCTCCCCCTGCTCACGCTTGGCACGGCGCTCGCCT
CC
CTCGGCTGGGCCCAAGGCAGCAACTTCAGCCCCGAAGCCTGGCTGCAGCAGTATGGCTACCTACCTCC
A
GGGGACCTGCGTACCCACACACAACGCTCACCCCAGTCACTCTCAGCTGCCATTGCCGCCATGCAAAAG
TTC
TATGGTTTACAAGTGACAGGCAAGGCTGATTTGGCAACCATGATGGCCATGAGGCGCCCTCGCTGTG
GT
GTTCCGGATAAGTTTGGGACTGAGATCAAGGCCAATGTTCGGAGGAAGCGCTATGCCATTCAGGGCCT
C
AAGTGGCAGCATAATGAGATCACTTTCTGCATTCAGAATTACACCCCTAAGGTGGGCGAGTATGCCACA
TTC
GAGGCCATTCGGAAGGCCTTCCGAGTATGGGAGAGTGCCACGCCACTGCGCTTCCGAGAAGTGCCCT
AT
GCCTACATCCGGGAGGGACATGAGAAGCAGGCTGACATCATGATCTTGTTTGCTGAGGGTTTCCACGG
C
GACAGTACACCCTTTGATGGTGAAGGAGGGTTCCTGGCTCATGCCTACTTCCCAGGCCCCAATATTGGA
GGG
GATACCCACTTTGATTCTGCCGAGCCCTGGACTGTCCAAAATGAGGATCTAAATGGGAATGACATCT
TC
TTGGTGGCTGTGCATGAGTTGGGGCATGCCCTAGGCCTGGAACATTCCAATGATCCCTCCGCCATCAT
G
GCCCCCTTTTACCAGTGGATGGACACAGAGAACTTCGTGTTGCCTGATGACGATCGCCGTGGCATCCAG
CAA
CTTTATGGAAGCAAGTCAGGGTCACCCACAAAGATGCCCCCTCAACCCAGAACTACCTCTCGGCCCT
CT
GTCCCAGATAAGCCCAAAAACCCCGCCTATGGGCCCAACATCTGTGACGGGAACTTTGACACCGTGGC
C
ATGCTCCGAGGAGAGATGTTTGTCTTCAAGGAGCGATGGTTCTGGCGGGTGAGGAATAACCAAGTGATG
GAT
GGATACCCAATGCCCATTGGCCAATTCTGGAGGGGCCTGCCTGCATCCATCAATACTGCCTACGAGA
GG
AAGGATGGCAAATTTGTCTTCTTCAAAGGAGATAAGCACTGGGTGTTTGACGAAGCCTCCCTGGAACC
C
GGGTACCCCAAGCACATTAAGGAGCTGGGCCGAGGGCTGCCCACGGACAAGATCGATGCAGCTCTCTTC
TGG
ATGCCCAATGGGAAGACCTACTTCTTCCGGGGCAATAAGTACTACCGGTTCAATGAAGAATTCAGGG
CA
GTGGACAGCGAGTACCCTAAAAACATCAAAGTCTGGGAAGGAATCCCTGAATCTCCCAGGGGGTCATT
C
ATGGGCAGTGATGAAGTCTTCACATACTTCTACAAGGGAAACAAATACTGGAAGTTCAACAACCAGAAG
CTG
AAGGTAGAGCCAGGGTATCCCAAGTCAGCTCTGCGGGACTGGATGGGCTGCCCTTCGGGGGGCCGGC
CC
GATGAGGGGACTGAGGAGGAGACGGAGGTGATCATCATTGAGGTGGATGAGGAGGGCAGTGGAGCTGT
G
AGTGCGGCCGCCGTGGTCCTGCCGGTACTACTGCTGCTCCTGGTACTGGCAGTGGGCCTCGCTGTCTTC
TTC
TTCAGACGCCATGGGACGCCCAAGCGACTGCTTTACTGCCAGCGTTCGCTGCTGGACAAGGTCTGA


Translation (582 aa):
MSPAPRPSRSLLLPLLTLGTALASLGWAQGSNFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQK
F
YGLQVTGKADLATM
MAMRRPRCGVPDKFGTEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYAT
F
EAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIG
G
DTHFDSAEPWTVQNEDLN
GNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQ
Q
LY
GSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM
D
GYPMPIGQFWRGLPASINTAYERKDGKFVFFK
GDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
W
MPNGKTYFFRGN
KYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQK
L
KVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVF
F
FRRHGTPKRLLYCQRSLLDKV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser