NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36863.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36863.1 Public Mus musculus 14 Ncoa4 21 106 86 CCDS HistoryNCBI Gene:27057Re-query CCDS DB by CCDS ID:36863.1Re-query CCDS DB by GeneID:27057See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36863.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111994 ENSMUSP00000107625 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111994Link to Ensembl Protein Viewer:ENSMUSP00000107625Re-query CCDS DB by Nucleotide ID:ENSMUST00000111994Re-query CCDS DB by Protein ID:ENSMUSP00000107625
Original member Current member EBI,WTSI ENSMUST00000163336 ENSMUSP00000126071 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000163336Link to Ensembl Protein Viewer:ENSMUSP00000126071Re-query CCDS DB by Nucleotide ID:ENSMUST00000163336Re-query CCDS DB by Protein ID:ENSMUSP00000126071
Original member Current member EBI,WTSI OTTMUST00000093552 OTTMUSP00000051929 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093552Link to Vega Protein Viewer:OTTMUSP00000051929Re-query CCDS DB by Nucleotide ID:OTTMUST00000093552Re-query CCDS DB by Protein ID:OTTMUSP00000051929
Original member Current member EBI,WTSI OTTMUST00000093554 OTTMUSP00000051931 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093554Link to Vega Protein Viewer:OTTMUSP00000051931Re-query CCDS DB by Nucleotide ID:OTTMUST00000093554Re-query CCDS DB by Protein ID:OTTMUSP00000051931
Original member Current member NCBI NM_001033988.2 NP_001029160.1 Accepted alive Link to Nucleotide Sequence:NM_001033988.2Link to Protein Sequence:NP_001029160.1Re-query CCDS DB by Nucleotide ID:NM_001033988Re-query CCDS DB by Protein ID:NP_001029160Link to BLink:NP_001029160.1
Original member Current member NCBI NM_019744.4 NP_062718.2 Accepted alive Link to Nucleotide Sequence:NM_019744.4Link to Protein Sequence:NP_062718.2Re-query CCDS DB by Nucleotide ID:NM_019744Re-query CCDS DB by Protein ID:NP_062718Link to BLink:NP_062718.2

Chromosomal Locations for CCDS 36863.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 32170762 32170902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32172303 32172443 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32172607 32172695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32172889 32172997 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32173401 32173490 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32174390 32174533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32175939 32176955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32177233 32177373 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 32177823 32177828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1878 nt):
ATGAACACATCCCTGGAACAGAGTGGCTGCTACAGTAATAGAGAAACTCTTCTGAGGTGCAGTGATGCAA
GG
AGGGAGCTGGAGCTTGCTATTGGTGGAGTACTTCGGGCTGAACAGCAAATTAAAGATAATTTACGAGA
G
GTAAAAGCTCAGATTCACAGCTGCATAAGTCGCCACCTGGAATGCCTTCGGAGCCGAGAGGTGTGGCTC
AAT
GAACAGGTCGATCTCATCTATCAGCTTAAAGAGGAGACACTGCAGCAGCAGGCTCAGCAGCTCTATT
GG
CTAATGGGCCAATTCAATTGTCTTATTCATCAACTGGAGTATACTCAGAACAAAGATCTTGCCAATCA
A
GTCTCTGTGTGCTTGGAGAGACTGGGCAGTTTGGCCCTGAAGCCTGAAGATTCAACTGTCCTACTCTTT
GAA
GCAGATACATCTGCTCTGCGCCAGACCATCACCACATTTGGATCCCTTAAGACCATTCAAATCCCTG
AG
CATCTGATGGCTCACGCGAGCTCCTCAAGTATTGGGCCTTTCCTAGAGAAAAGAGGCTATATCCAGGT
G
CCAGAGCAGAAGTCAGCATCCAGTGGCACAGCTGTATCTCTGAGTGAGTGGCTTCTTGTAAGCAAACCT
GCC
ATTGGTCTTCAGGCTCCTTATGTACCCAGTACCAACCCACAGGACTGGCTTATCCCAAAACAGACTT
CA
GAGAATAGTCAGACTTCTGCCAGAGCCTGCAGTTTCTTCAGCGATGCCTGGGGCAATCTGAAGGGCTT
A
GAAAATTGGCTCCTTAACAGTCATCAACAAGAAATTGCTGGAAAACCAAGTTCCTCAAAATGTAACAGC
CAT
TGTAGCACCAGTTCTTTCTCTCCTGAAGCTGAAAAGGCTGAAGATGTAGAGCTCCTTGATCAAGACG
AG
CTGGACCTGTCTGATTGGTTGGTGACTCCTCAGGAACCCTGTGAGCTGGAGAAGCCTGTGGATGGCAG
C
TGGGAAACCAGCGAGAAGTTTAAACTCTTGTTCCAGGTGTTCAGAGAGCCCTACAATGTGAGTGATTGG
CTT
GTCAAGCCTGACTCCTGTACCAACTGTCAGGGCAACCAGCCTAGAGGTGTGGAGATTGAGAACCTGG
GC
AATCTGAAATGCCTAAATGACCACTTGGAGGCCAAAAAATCAGTGTCGGTCCCCGGCGCAACAATCAG
C
GACGGCTGGCTTGCCCAGAACCATCAGGACACATGGAAAGTAGAGGAAGTGTGTAAAGCCAACGAGCCC
TGC
ACCAGTTTTGCAGAGTGTGTGTGTGATGACAACTGTGAGAAGGAAGCCATGTATAAATGGCTTCTGA
AG
AAGGGAGGAAAGGACAAGAATGGAATGCCTATGGAACCTAAATCTGAGCCTGAGAAACACAGAGAGTC
C
CTGACACTGTGGCTCTGCCCTTCCAGAAATGAGCTAACAGAACAAGCTAAGGCACCCAAGGCTATGGCT
CCT
GCTAGAATTGCTGATTCCTTCCACGTCATAAAGAATAGTTCCTTGTCAGAGTGGCTTATGGGGCCTA
CG
TGCAAAGGAGGCCCTAAGGACGTGCCTAATACAGAGGAGAGAGCTGGCAAAGAGATGCTTCAAAGCTC
C
ATGGCCACTTCCTGGTGTCCCTTTAACACTGCCGACTGGGTTTTACCAGGAAAGAAAGTGGGAAGCCTC
AGC
CAGTTCCCCTCTGGAGAAGATAAGTGGCTACTTCGAAAGAAGGCACAGGAAGCATTTCTTAATTCAC
CC
CTACAAGAAGAACGTAACTTTCGCCCCGACTGTTACGGCCTCCCAGCAGTTTGTGATCTCTTTGCCTG
T
ATGCAGCTTAAGGTTGATAAAGAAAAATGGCTGTACAGAACTCCTCTACAGATGTGA


Translation (625 aa):
MNTSLEQSGCYSNRETLLRCSDARRELELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL
N
EQVDLIYQLKEETLQQQAQQLYW
LMGQFNCLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLF
E
ADTSALRQTITTFGSLKTI
QIPEHLMAHASSSSIGPFLEKRGYIQVPEQKSASSGTAVSLSEWLLVSKP
A
IGLQAPYVPSTNPQDWLIPKQTSENSQ
TSARACSFFSDAWGNLKGLENWLLNSHQQEIAGKPSSSKCNS
H
CSTSSFSPEAEKAEDVELLDQDELDLSDWLVTPQEPCELEKPVDGSWETSEKFKLLFQVFREPYNVSDW
L
VKPDSCTNCQGNQPRGVEIENLGNLKCLNDHLEAKKSVSVPGATISDGWLAQNHQDTWKVEEVCKANEP
C
TSFAECVCDDNCEKEAMYKWLLKKGGKDKNGMPMEPKSEPEKHRESLTLWLCPSRNELTEQAKAPKAMA
P
ARIADSFHVIKNSSLSEWLMGPTCKGGPKDVPNTEERAGKEMLQSSMATSWCPFNTADWVLPGKKVGSL
S
QFPSGEDKWLLRKKAQ
EAFLNSPLQEERNFRPDCYGLPAVCDLFACMQLKVDKEKWLYRTPLQM



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser